KEGG   Kitasatospora albolonga: B7C62_23505Help
Entry
B7C62_23505       CDS       T05009                                 

Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
kab  Kitasatospora albolonga
Brite
KEGG Orthology (KO) [BR:kab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B7C62_23505
Enzymes [BR:kab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     B7C62_23505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: ARF74866
UniProt: A0A1V0VBR2
Position
5279420..5280301
Genome map
AA seq 293 aa AA seqDB search
MTEQLRLMAVHAHPDDESSKGAATMAKYVSEGVDVLVVTCTGGERGSILNPKLQGDAYIE
KNIHEVRKKEMDEAREILGVQQEWLGFVDSGLPEGDPLPPLPEGCFALEDPRLAAGRLVA
KIRAFRPQVITTYDENGGYPHPDHIMTHTISMIAFDGAADAEAFPEEEFGPVWTPQKLYY
NQGFNRPRTVALHEALLARGLESPYGEWLERWKEFERVERTLTTHVPCDEFFEIRDKALI
AHATQIDPEGGWFRVPMEIQREVWPTEEYELAKSLVDTSLPESDLFAGIRDNA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgactgagcagctgcggctgatggccgttcacgcccaccccgacgacgagtcgagcaag
ggcgcggccacgatggccaagtacgtgtccgagggggtggacgtgctggtcgtgacctgc
acgggaggcgagcgcggctccatcctgaacccgaagctccagggcgacgcgtacatcgag
aagaacatccacgaggtgcgcaagaaggagatggacgaggcccgggagatcctgggcgtc
cagcaggagtggctgggcttcgtcgactccgggctccccgagggcgacccgctgccgccg
ctgcccgagggctgcttcgccctggaggacccgcggctcgcggccgggcggctggtggcg
aagatccgggcgttccggccgcaggtcatcaccacgtacgacgagaacggcggctacccg
caccccgaccacatcatgacgcacacgatctcgatgatcgcgttcgacggcgcggccgac
gcggaggcgttcccggaggaggagttcggcccggtctggaccccgcagaagctctactac
aaccagggcttcaaccggccgcgcacggtcgccctgcacgaggcgctcctcgcccgcgga
ctggagtcgccgtacggggagtggctggagcgctggaaggagttcgagcgggtcgagcgc
acgctgaccacgcacgttccctgcgacgagttcttcgagatccgcgacaaggcgctcatc
gcgcacgccacgcagatcgaccccgagggcggctggttccgggtcccgatggagatccag
cgggaggtctggccgaccgaggagtacgagctggcgaagtctctcgtcgatacttccctc
cccgagagcgacctcttcgcgggcatccgcgacaatgcctga

DBGET integrated database retrieval system