KEGG   Kitasatospora albolonga: B7C62_26800Help
Entry
B7C62_26800       CDS       T05009                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
kab  Kitasatospora albolonga
Pathway
kab00250  Alanine, aspartate and glutamate metabolism
kab00330  Arginine and proline metabolism
kab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B7C62_26800
   00330 Arginine and proline metabolism
    B7C62_26800
Enzymes [BR:kab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     B7C62_26800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ARF75461
UniProt: A0A1V0VDP0
Position
6051154..6052785
Genome map
AA seq 543 aa AA seqDB search
MDAVTQVPAPVNEPVHSYAPGSPERARLEVKLKELADNPIDLPMTIGGEKRMGGGERVNV
VQPHNHQAVIGTFAGATEQDAQDAIDAALAAAPAWRAMSFDDRAAIILRAAELLAGPWRE
TLAASTMLGQSKTAQQAEIDTPCELVDFWRFNVHYARQILAEQPPANSPGVWNRMDHRPL
EGFVYAITPFNFTAIAGNLPTAPALMGNVVVWKPSPTQTHAAVLLMQLLEEAGLPKGVIN
LVTGDGIAVSEVALNHRDLAGIHFTGSTPTFQHLWKTVGNNIATYRTYPRLVGETGGKDF
VVAHPSADRAVLKTALTRGSFEFQGQKCSASSRAYVPASIWNSGFKEEFAAEVDSIKMGD
VTDLSNFIGAVIDDRSFAKNKAAIDRAKTDPACTIVAGGTYDDSVGYFVRPTVIECTDPE
NEVFTTEYFGPILAVHVYEDENYDAMLEQMESVSDYALTGSVIAGDRAAAAYTMEKLRYA
AGNFYINDKSTGAVVGQQPFGGGRASGTNDKAGAPQNLQRWTLTRAIKETLVPPTDYTYP
HQG
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgtcacccaggtccccgcgccggtcaacgagccggttcactcctacgccccg
ggctccccggagcgcgcccgcctggaggtgaagctcaaggagctcgccgacaacccgatc
gacctgccgatgaccatcggcggcgagaagcggatgggcggcggcgagcgggtgaacgtc
gtgcagccgcacaaccaccaggccgtcatcggcaccttcgccggggccaccgagcaggac
gcccaggacgccatcgacgcggccctcgccgccgctccggcctggcgcgcgatgtccttc
gacgaccgcgcggcgatcatcctgcgcgccgccgagctgctggcgggcccctggcgcgag
acgctggccgcctccaccatgctcggccagtccaagaccgcccagcaggccgagatcgac
accccctgcgagctcgtcgacttctggcgcttcaacgtgcactacgcgcgccagatcctc
gccgagcagcccccggccaactccccgggcgtgtggaaccgtatggaccaccgcccgctg
gagggcttcgtctacgcgatcacgccgttcaacttcacggccatcgcgggcaacctcccc
accgcccccgccctcatgggcaacgtcgtggtgtggaagccgtccccgacccagacccac
gccgccgtgctgctgatgcagctcctggaggaggccgggctgcccaagggcgtcatcaac
ctggtcaccggcgacggcatcgccgtctccgaggtggcactgaaccaccgcgacctggcc
ggtatccacttcaccggctcgacccccaccttccagcacctgtggaagacggtcggcaac
aacatcgccacctaccgcacctacccgcggctcgtcggcgagaccggcggcaaggacttc
gtcgtcgcgcaccccagcgccgaccgcgccgtgctgaagaccgcgctgacccgcggctcc
ttcgagttccagggccagaagtgctccgcgtcctcgcgtgcgtacgtccccgcctccatc
tggaactccggtttcaaggaggagttcgcggccgaggtcgactccatcaagatgggtgac
gtcaccgacctgagcaacttcatcggggccgtcatcgacgaccgctcgttcgccaagaac
aaggccgcgatcgaccgcgccaagaccgacccggcgtgcacgatcgtcgcgggcggcacc
tacgacgactcggtgggctacttcgtccgcccgacggtcatcgagtgcaccgaccccgag
aacgaggtcttcacgaccgagtacttcggcccgatcctcgcggtccacgtctacgaggac
gagaactacgacgcgatgctggagcagatggagtcggtctccgactacgcgctgaccggc
tcggtcatcgcgggcgaccgcgccgccgccgcgtacacgatggagaagctccgctacgcc
gcgggcaacttctacatcaacgacaagtcgaccggcgccgtcgtcggccagcagcccttc
ggcggcggccgcgcctccggcaccaacgacaaggcgggcgccccgcagaacctccagcgc
tggaccctcacccgggccatcaaggagaccctggtcccgccgaccgactacacctacccc
caccagggctga

DBGET integrated database retrieval system