KEGG   Kitasatospora albolonga: B7C62_29245Help
Entry
B7C62_29245       CDS       T05009                                 

Definition
(GenBank) cytidyltransferase
  KO
K00980  glycerol-3-phosphate cytidylyltransferase [EC:2.7.7.39]
Organism
kab  Kitasatospora albolonga
Pathway
kab00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:kab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B7C62_29245
Enzymes [BR:kab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.39  glycerol-3-phosphate cytidylyltransferase
     B7C62_29245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: ARF75896
UniProt: A0A1V0VEM7
Position
complement(6605922..6606371)
Genome map
AA seq 149 aa AA seqDB search
MVQHRVGYAPGVYDLFHVGHLNILRHARSQCDYLVAGVVSDEMAALAKGHTPVIPLRERL
EIVRSVRFVDAAFVETVPDKVETWQQVRFDVIFKGDDWRGTDKGKKLERDFAEVGVEVVY
FPYTVHTSSTQLRRALDVLVSRDGALSAP
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagcacagggtggggtacgcacccggggtgtacgacctgttccacgtgggccac
ctcaacattctgcggcacgcccgcagtcagtgcgactacctggtcgcgggggtcgtctcg
gacgagatggccgccctcgccaagggccacacgcccgtcatcccgttgcgcgagcggctg
gagatcgtgcgcagcgtccggttcgtggacgccgcgttcgtggagaccgtgccggacaag
gtggagacctggcagcaggtccggttcgacgtcatcttcaagggcgacgactggcggggc
acggacaaggggaagaagctggagcgcgacttcgccgaggtcggcgtggaggtcgtctac
ttcccgtacaccgtgcacacgtccagcacccagctgcgccgggcgctggacgtgctcgtc
agccgggacggagcgctctcagctccctga

DBGET integrated database retrieval system