KEGG   Kitasatospora albolonga: B7C62_34545Help
Entry
B7C62_34545       CDS       T05009                                 

Definition
(GenBank) ferredoxin-NADP reductase
  KO
K00528  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
kab  Kitasatospora albolonga
Pathway
kab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kab00001]
 09100 Metabolism
  09112 Not included in regular maps
   09113 Global maps only
    B7C62_34545
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B7C62_34545
Enzymes [BR:kab01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     B7C62_34545
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     B7C62_34545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer4 Fer4_7 NAD_binding_8 Fer4_16 Fer4_2 Fer4_6 Pyr_redox Fer4_10 Fer4_9 Fer4_21 NAD_binding_9 HI0933_like Fer4_4 Fer4_8 FAD_oxidored FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ARF76839
UniProt: A0A1V0VHC4
Position
7950601..7952253
Genome map
AA seq 550 aa AA seqDB search
MTYAITQTCCSDATCVAVCPVNCIHPTPEERAFGSTEMLYVDPRTCIDCGACADACPVDA
IFPVDSLFGAQKEYAAINAAYFTDRKPEPAPDGPNFHVWGEPTFERSLPADFAPIRVAVV
GTGPAGMYAAEDLLLHTNAEVTLVDRLPVAGGLVRYGVAPDHPATKKAGETFARFHSHPR
VRMHLGVEVGKDITAQELAAHHDAVIYAVGASADRRLGIQGEELPGSGSATSFVSWYNAH
PEVAPESVRLTAERVVVVGNGNVALDVARILVMDPDTLAGTDIADHALAALRESRVREVV
LLGRRGPEDAACTASELLALKHLPGVGLLVDDHDPRTGAAIDGAAPGSKAALLGDVERRA
VDWARPPGPGRRIVFRFHSAPVAALGEDAVTAVRVTEGPGERDIPAGLLLRAIGYRGVAV
PGLPFDEASGTVPHEGGRVSGMTGTYVVGWIKRGPSGGIGANRTCAAETVGTLLADAVAG
ALTAPAHPPAAFRRLTRGRGRDVVDARGLAAIDRAEVARGREHGRPRVKLGTVPALVAAA
KGRRRWRARG
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgccatcacccagacctgctgctccgacgccacctgcgtcgccgtctgcccc
gtcaactgcatccacccgacccccgaggagcgggcgttcggcagtacggagatgctctac
gtcgacccgcggacctgcatcgactgcggagcctgcgccgacgcctgcccggtcgacgcg
atcttcccggtggacagcctcttcggggcgcagaaggagtacgccgccatcaacgcggcc
tacttcaccgaccggaagcccgaacccgcccccgacgggccgaacttccacgtctggggc
gagcccaccttcgagcgcagcctgcccgccgacttcgccccgatccgggtggccgtcgtc
ggcaccgggcccgccggcatgtacgccgccgaggacctgctgctgcacaccaacgccgag
gtcaccctggtcgaccggctgccggtggcgggcggcctcgtccgctacggcgtagcgccc
gaccaccccgccacgaagaaggcgggcgagaccttcgcccgcttccactcccacccccgg
gtacggatgcacctgggtgtcgaggtcggcaaggacatcacggcccaggagctcgccgcg
caccatgacgcggtgatctacgcggtcggcgcctccgccgaccgcaggctcggcatccag
ggtgaggagctgcccggcagcggctcggccacctcgttcgtctcctggtacaacgcccac
ccggaagtggcacccgaatccgtgcgcctgaccgcggaacgcgtggtcgtcgtcggcaac
ggcaacgtcgccctcgacgtcgcgcgcatcctcgtcatggacccggacacgctggcgggc
accgacatcgccgaccacgcgctcgcggcgctgcgggagtcccgggtgcgcgaggtcgtc
ctgctggggcggcgcggccccgaggacgcggcctgcaccgcctccgagctgctcgccctg
aagcacctgcccggtgtcggcctgctcgtcgacgaccacgaccccaggaccggcgccgcg
atcgacggggcggccccggggtcgaaagcggccctcctcggggacgtggagcgccgggcc
gtggactgggcgcggccgcccggacccgggcggcgcatcgtcttccgcttccactccgcc
ccggtggcggcgctcggcgaggacgccgtcaccgccgtacgtgtcacggaggggccgggg
gagcgggacatcccggcgggcctgctgctgcgggcgatcggctaccggggcgtggccgtg
ccgggcctgcccttcgacgaggcgtccgggaccgtaccgcacgaggggggcagggtgagc
ggcatgacgggaacgtacgtcgtcggctggatcaagcgcggcccctcgggcggcatcggc
gccaaccgcacctgcgcggccgagaccgtcggaacgttgctggccgacgccgtggcgggc
gccctgaccgccccggcccacccgcccgccgcgttccgccgcctcacccgcggccggggc
cgcgatgtcgtcgacgcccgggggctggccgccatcgaccgggcggaggtggcccggggc
cgcgagcacggccgcccgcgcgtcaagctcggcacggtgcccgccctggtcgcggcggcg
aaggggcggcgtcgctggagggcccggggctga

DBGET integrated database retrieval system