KEGG   Kazachstania africana: KAFR_0A02050Help
Entry
KAFR_0A02050      CDS       T02487                                 

Gene name
KAFR0A02050
Definition
(RefSeq) hypothetical protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
kaf  Kazachstania africana
Pathway
kaf00790  Folate biosynthesis
kaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KAFR_0A02050 (KAFR0A02050)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kaf04147]
    KAFR_0A02050 (KAFR0A02050)
Enzymes [BR:kaf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     KAFR_0A02050 (KAFR0A02050)
Exosome [BR:kaf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KAFR_0A02050 (KAFR0A02050)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 13882167
NCBI-ProteinID: XP_003954778
UniProt: H2AMP3
Position
1:complement(428111..428473)
Genome map
AA seq 120 aa AA seqDB search
MYNKIVRTQPLKLVTRDLEDSLVKLKLNSTWKINENRTSLIRECVFPDFESTWAFLTRVS
MRSHLWGHHPTITTSFNKVKLELSTHDLDDKGAISDIDLKMANRIEKYINIYNDKIRNLD
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgtataacaaaatagtaaggacacagccattaaagcttgtaacaagagatttggaagat
tcactagtgaaattaaagctcaattctacgtggaagataaatgaaaatcgtacctcactt
ataagggaatgtgtttttcctgatttcgagagcacttgggcatttcttacaagagtatca
atgagatcacatctttggggtcatcatcccacgataacgaccagttttaataaagtcaag
ttggaattgagcacgcatgatttggatgataaaggtgccataagtgatattgatttgaaa
atggcaaacaggattgaaaaatacataaatatatacaacgataagataagaaatttagac
tga

DBGET integrated database retrieval system