KEGG   Kazachstania africana: KAFR_0A05090Help
Entry
KAFR_0A05090      CDS       T02487                                 

Gene name
KAFR0A05090
Definition
(RefSeq) hypothetical protein
  KO
K06660  cell cycle serine/threonine-protein kinase CDC5/MSD2 [EC:2.7.11.21]
Organism
kaf  Kazachstania africana
Pathway
kaf04111  Cell cycle - yeast
kaf04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KAFR_0A05090 (KAFR0A05090)
   04113 Meiosis - yeast
    KAFR_0A05090 (KAFR0A05090)
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     KAFR_0A05090 (KAFR0A05090)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 13886298
NCBI-ProteinID: XP_003955080
UniProt: H2ANJ5
Position
1:1011918..1013924
Genome map
AA seq 668 aa AA seqDB search
MPPLKRKSVEFDLGDKYNEPDIPDTPRLTISRKRKDSHTTIHVPYLAGPYKQLNKIGKGS
HSIVYKVTHPTSDATLALKKLPINDYKLKTNRRSTILKEIEIHKLVNGHKNIISMIDHFE
IDATMYMVLELCGAGSLYDIICRSKRSLREWEAKRLMIQLCGAVDWIHEKNIVHADLKLS
NILIDSSNNLQLCDFGHSFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKES
DIWSIGIVLYAMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQP
LERKTIVEIVSDDWFHTSYFPDEINLRENNSDLNSMFENELSTVSRYYSLTNYINCLIDA
GLKKYLITPGNHNKNLQKKERRFMEGTHGVTKSKKYGKFDRQLKCLQDLSALKQLERLGK
LSSNYFKILNSTSLNVEKANEILRDQCYFSLLSLNEAAYITELTQQRMPSRDSISTLKAP
IMVSTIHQEENGVIRYQLSNQDIGSIYPNSHSLLRVKEEDAFWYICPDNEKGWISKYFDK
AKIPKEFIELLTEVEQFGSKISNVSSNLPFITKSSTTEADIFLRKYTKFENFELFELSNA
LQFNFEDSGSIISIHENGQLISFNTMSNNEVLTMPLSAFYGSSEYNILADKINIIKCCLQ
IRTTMSES
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctttgaagaggaaaagtgtagagtttgatctcggtgataaatataatgagcca
gatattcctgatacacccagattaacaatatcaagaaaacgtaaggattcacatacaaca
attcatgtgccatatttagccggtccttacaaacaattgaataagataggcaaaggatca
cattctatagtctataaagtgacacatccaacaagtgatgctactttagccttaaaaaaa
ttaccaatcaatgattataaattaaagacaaacagaagatctacaattttgaaagaaatt
gaaattcataaattagttaacggccacaaaaatattatatcaatgatagaccattttgaa
atagatgctaccatgtatatggttcttgaactttgtggagctggaagtttgtacgatatt
atatgcagatctaagagatcattgagagaatgggaagccaagagattaatgattcaattg
tgtggtgcggttgattggatacatgaaaagaatattgttcatgctgatttgaaactatca
aatattttgattgactcgtcaaataatttacagttatgtgattttggccattcttttgta
agtaccgacattgacaataactcgatcaataaattcggtacgccgaactacttatctccc
gaaattatctcaaatttcatcttaagtgataagaaggacttgtattttccaaaggaaagt
gatatttggtcaatagggattgttttgtacgcgatgatttttgataagacaccatttgag
gcaacaacattgagatctacctatgaaaacatagtggaatgtaaatatggttttgttgaa
aataagagggtttcaaataaagtgaagaagctgattcaaaatattttaaaaatacagcca
ttagaaagaaaaacaattgttgaaattgtttctgatgactggttccacacatcttatttc
ccagatgaaataaatctgagagaaaataactcagacttaaattctatgttcgagaatgag
ctctcgacagtgtcaaggtattattcattgacaaactatatcaattgtttaattgatgca
ggattgaagaaatatctaattaccccaggcaatcataataaaaatttacaaaaaaaagag
cgtaggtttatggaaggaacgcatggtgtgaccaaatctaaaaaatatggtaaatttgac
aggcaattgaaatgcttacaagacttatcagctcttaagcaacttgaaagattgggaaaa
ttaagtagcaactatttcaagattttgaattctactagcttaaatgtcgaaaaggcaaat
gagattttgagagatcaatgctatttcagtcttctaagtctaaacgaggctgcctatata
acagaactgactcaacagcgtatgccaagccgtgactccatttcgacattaaaggcacca
atcatggtgtcaacaatacatcaggaggaaaatggtgtcattcggtaccaactatctaat
caagatataggctcaatttacccaaacagtcatagtctccttcgggtcaaagaagaagat
gcattttggtatatctgtcctgataatgagaaaggatggatatctaaatattttgataaa
gccaagatacccaaggaatttattgaacttttaacagaggttgaacagtttggttcgaaa
atttccaacgtctcatcaaatttaccatttattacaaaaagttccaccacagaagcggac
attttcctcaggaaatatacaaaatttgagaatttcgaactatttgagttaagtaatgct
ttgcaattcaatttcgaagattctggaagcattatatccatccatgaaaatggacagctt
atttctttcaatacaatgtcaaataatgaagtccttaccatgccattgtctgctttttac
ggcagtagcgaatataatattttggcagataaaattaatattatcaaatgctgtctgcag
atcagaacaacaatgagcgaaagttaa

DBGET integrated database retrieval system