KEGG   Kazachstania africana: KAFR_0B01050Help
Entry
KAFR_0B01050      CDS       T02487                                 

Gene name
KAFR0B01050
Definition
(RefSeq) hypothetical protein
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
kaf  Kazachstania africana
Pathway
kaf00780  Biotin metabolism
kaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KAFR_0B01050 (KAFR0B01050)
Enzymes [BR:kaf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     KAFR_0B01050 (KAFR0B01050)
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     KAFR_0B01050 (KAFR0B01050)
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     KAFR_0B01050 (KAFR0B01050)
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     KAFR_0B01050 (KAFR0B01050)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_N BPL_LplA_LipB BPL_C
Motif
Other DBs
NCBI-GeneID: 13882627
NCBI-ProteinID: XP_003955538
UniProt: H2APV3
Position
2:195058..197118
Genome map
AA seq 686 aa AA seqDB search
MNILVYNGPGTTPGSVRHAVETFRQFLEPYYAINVASPKVLETEPWITKTAAIVFPGGAD
LPYVRECRPFMNKIRDYIYKSGGLYIGFCAGGYFGSKRVEFCQGIPNMEVTGGRDLQFFP
GIARGPAYGTYKYNSEEGACAAKLLVNNGNVVYNYFNGGAVFVDADKCDNVEVLAHYSDS
TSVSFSDSVPFHGKPAAVVLCEVGRGKALLTGAHPEFTPKIMEQSQESGHLSQAILQVLK
DNDKQRLQFLQYIFSKAGLHCNDSFGENKRPDLTPLLVCSRDKSKVDTFKDMIVQNMKDL
VEVDGRSETSGESNTFKFYEGFNSQYAVVTNSLRGIDPENAPVSIIFPSVDEGLPDKSFI
SHFDVQKYFKHLHSQNSLGSLLLYGDVVTSTSSMLNQNHSFVKSMPDNSVLHVGTIQVLG
KGRGGNAWVNPRGVSASTAVVSVPTQSPTTGKPVPFVFVQYIAMLAYCEAIFSYGDGYED
LPIRIKWPNDLYALDPKYYHNNKMTLLGGGLNSHAVPLQEREPAFCKISGLLVNTFFDID
KYILLLGCGLNVDNNGPTTSLNGWVRLLNQERENAHLQPLPPIEIEVLQALCMNRLQSLL
KKFIDCGAEAVLPEYYKFWLHSNQVVKLSEHGNVLAKITGITEDYGLLIAKELVMGGDSE
FTGTIYHLQPDGNTFDIFKGLIARKV
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttagtttacaacggcccaggtacaacacctgggtcagtaaggcatgcagtt
gagacgtttcgtcagtttctagagccttattatgcaattaatgttgcctcgccaaaggtt
ctagaaactgaaccttggataaccaagaccgctgccattgtcttcccaggtggtgctgat
ttaccgtatgtgagagagtgtagaccattcatgaataaaataagagattatatctataag
tctggcggattatacattggcttctgcgctggtggatattttggctcaaagagagttgaa
ttttgccaaggcattccaaacatggaggttactggtggaagagatctacagtttttccct
ggaatagcaagagggcctgcttatggaacctacaagtataatagtgaagaaggagcctgc
gctgcaaaacttctagttaataatggcaatgtggtgtacaattattttaatggtggagcc
gtctttgttgatgcagataaatgtgataatgtagaagttttagctcattatagtgacagt
acctctgtttccttttcagatagtgtaccgtttcatggaaaacctgcagcagtagtgctt
tgtgaagtaggaagagggaaagcactacttactggagctcatccagagtttacacctaaa
ataatggaacaatcgcaagagtcgggccacctatctcaggctatattacaagttcttaaa
gataatgacaagcagcgattgcagtttttgcaatatatcttctcaaaagctggcctacat
tgtaatgatagttttggtgaaaataaaagacctgatttgacgccactattggtatgttca
agagataaaagtaaggtcgatacatttaaagatatgatagtacagaatatgaaggacttg
gtcgaagtcgacggccgtagtgagacatcgggagaaagtaatacgttcaaattttacgaa
ggattcaatagtcaatacgctgttgttactaatagtttaagaggcattgatcctgaaaat
gctcctgtaagtataatatttcctagtgtcgatgaggggctaccagacaagtcttttatt
tcacactttgatgtccagaagtattttaagcatttgcactctcaaaattcgttggggtca
ctgctgctttatggggacgttgtgacttcaacaagctctatgctgaaccaaaaccatagt
tttgtaaaatcaatgccagataattcagttctacatgttggaactattcaggtcctaggt
aaaggtagaggaggtaacgcgtgggtcaatccaagaggtgtgtcagcttctaccgctgta
gtttctgtacccacacaatctccaacgacaggaaaaccagtgccatttgtatttgtacaa
tatatcgcgatgttggcatattgtgaggccatattttcgtatggtgatggatatgaggat
ctccccataaggataaaatggccgaatgatctttacgccctagatccaaaatactaccat
aataacaagatgacattgttaggaggtgggctcaattcgcatgcggttccacttcaagaa
agagagccagctttttgtaaaatatcgggacttttggtcaataccttctttgacattgat
aaatatattcttcttttgggatgtggtttaaacgttgacaataatgggcctacaacatct
ctaaatggatgggtacgtctactgaaccaggagcgtgagaatgcacatctgcaaccctta
cctccgatcgaaatcgaagttcttcaagctctctgtatgaacagactacaatcacttctg
aagaagttcatagactgtggggctgaggcagtactacctgaatattacaaattttggttg
cactcaaaccaagttgtaaagttaagtgagcatggaaatgtattggccaaaataacaggt
attacagaggattatggtctcctcatagctaaggaacttgtcatgggaggtgattcagaa
ttcactgggacaatatatcatctacagcctgacggtaacacgtttgatatatttaaagga
ctcatcgcaagaaaagtgtag

DBGET integrated database retrieval system