KEGG   Kazachstania africana: KAFR_0B04450Help
Entry
KAFR_0B04450      CDS       T02487                                 

Gene name
KAFR0B04450
Definition
(RefSeq) hypothetical protein
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KAFR_0B04450 (KAFR0B04450)
Transcription machinery [BR:kaf03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     KAFR_0B04450 (KAFR0B04450)
Chromosome and associated proteins [BR:kaf03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    KAFR_0B04450 (KAFR0B04450)
   HAT complexes
    PCAF complex
     KAFR_0B04450 (KAFR0B04450)
    STAGA complex
     KAFR_0B04450 (KAFR0B04450)
    TFTC complex
     KAFR_0B04450 (KAFR0B04450)
    SAGA complex
     KAFR_0B04450 (KAFR0B04450)
    SLIK complex
     KAFR_0B04450 (KAFR0B04450)
    ADA-HAT complex
     KAFR_0B04450 (KAFR0B04450)
    HAT-A2 complex
     KAFR_0B04450 (KAFR0B04450)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 13883280
NCBI-ProteinID: XP_003955876
UniProt: H2AQU1
Position
2:complement(924637..926007)
Genome map
AA seq 456 aa AA seqDB search
MVSKRKAEQHNVDSLTSEDAHENKKMKLDDKPTEDTDTANKNGDYNEEDENKTQGENSGE
VDENADDNDMEETENDKVPETEIIDDSDRGIVKFEFDNVEYKFKERASVIEENEGKIEFR
VVNNDNTKENLMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITY
KPFDRREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVKNTSNIKYFLTYADNYAIGYFKK
QGFTKEITLDKKIWMGYIKDYEGGTLMQCSMLPRIRYLDAAKILLLQEAALRRKVRTISK
SHIVRPGLDQFRDLDNIKPIDPMTIPGLKEAGWTPEMDELAQRPKRGAHYAVMQNILTEL
QNHAAAWPFLQPVNREEVPDYYDFIKEPMDLSTMEIKLENNKYQKMEEFIRDVKLICSNC
RLYNGENTSYFKYANRLEKFFVGKMKEIPEYSHLVD
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaaaacgtaaggcagagcaacacaatgtcgactctttgacatctgaagatgca
catgaaaataaaaaaatgaaattagatgataaaccgacagaagatacagatacggcaaac
aaaaatggagattataatgaagaagatgagaacaaaactcaaggcgaaaattccggcgag
gtagatgaaaatgcagacgataatgacatggaggaaacagagaatgataaagtacccgaa
acagagatcatagatgatagcgatcgtggaattgttaagttcgagtttgataatgttgaa
tacaagttcaaggaaagagccagtgttattgaagaaaatgagggtaaaatagagttcaga
gttgttaataatgataatacgaaagaaaacttaatggttctgacgggtttaaagaatatt
ttccagaaacaactaccgaaaatgcctaaagaatatatagccagattagtctacgatcga
agtcatctttctatggcagttatccgaaagccattgacagttgttggtggaattacatat
aaaccatttgacaggagagaatttgcagaaattgtgttttgtgcaatcagttctactgaa
caagttcgtggttatggtgctcatctaatgaaccatttaaaagattatgtgaagaacacg
tctaatatcaaatattttctaacctacgctgataattatgcaatcggttattttaagaaa
caaggttttacaaaggaaattacgttagataaaaaaatatggatgggttatattaaggat
tatgagggagggacactaatgcaatgttcaatgttgcccagaatacgatatttagatgca
gccaagattctactattgcaagaagcagccttaagaagaaaagttagaacaatatcaaaa
tcacatatagtaagaccaggtctagatcagtttcgagatttagataatataaagccaatt
gaccctatgacgatacctggattgaaagaagctggctggacgccagaaatggatgaatta
gcccaaagaccgaagagaggtgcccattatgcagtaatgcagaatattttaactgagcta
caaaatcatgctgcagcttggccctttttacagcctgtcaacagagaagaggttcctgac
tactacgatttcatcaaggaaccaatggatttgagtacaatggaaatcaaattagagaat
aataaatatcaaaaaatggaggaatttatacgcgacgttaagctaatttgtagcaattgt
aggctatacaatggtgaaaacacatcctatttcaagtatgccaatagactagaaaaattc
ttcgtaggcaaaatgaaggaaattccagaatattcacatttggttgattaa

DBGET integrated database retrieval system