KEGG   Kazachstania africana: KAFR_0B05060Help
Entry
KAFR_0B05060      CDS       T02487                                 

Gene name
KAFR0B05060
Definition
(RefSeq) hypothetical protein
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
kaf  Kazachstania africana
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KAFR_0B05060 (KAFR0B05060)
Enzymes [BR:kaf01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     KAFR_0B05060 (KAFR0B05060)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DUF1344 Band_7
Motif
Other DBs
NCBI-GeneID: 13884684
NCBI-ProteinID: XP_003955937
UniProt: H2AR02
Position
2:1043706..1045295
Genome map
AA seq 529 aa AA seqDB search
MFNLTFRRYLITNKAPLLNANRRLSAPRSSIPGLSSRWLSTGMTQTAREPFYRRTTKSIF
RFTLLSTLAIGSYLTYEIYRESNPRKQAPQSLNLANGQKRKTLIILGSGWGSVSLLKNLD
TSLYNVILISPRNYFLFTPLLPSTPVGTIELKSIIEPVRTMIKRCKGEVKYFENSVQDID
PISKNITLNDGKIIDYDYLVVGVGSKPTTFNIPGVIENSSFLKEISDAKEIKSKIFKNIE
LASALENGDPLRKKLLSFVVVGGGPTGVEFAAELSDYIQQDINKWQPELQNDISITLVEA
APNILPSFNKELIQYAEELLSSKGKIQLKLNTIVKEVDSNYLKGLIKEQNSDHMEHIPYG
VLVWATGNAPRDICQSLMSKLKQQDSRRGLLINDKLQLLGAEDSIFAIGDCTFHPGLFPT
AQVASQEGKYLANIFKRLHKIERLAFEKKIRKIEIPDFKYKYKGALAYIGQDKAIADVVT
FGKTYPSAGSLTFYFWKSAYLTMLSSFRNKILVALDWTKVSMFGRNSSE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatttaacatttcgtagatatcttattacaaataaggcacctctattgaatgca
aatcgaagattgtcagcccctaggtcatcgatccccggactgtcttcgagatggttatca
accggtatgacgcaaactgcaagagagcctttctatagaagaactactaagtccatattc
agattcactcttctttcaacattagctataggtagctacttaacctacgaaatttataga
gagtcgaacccgagaaaacaagcgccacaatcattgaacttggcaaacggccaaaaacgt
aagactttaatcattttgggatcaggttggggatctgtatcattgttgaaaaatttagat
acgtctctatataatgtcatcctgatctccccaagaaattacttcctattcacgccattg
ttaccttccactccagtaggtaccattgaattgaaatctatcatcgaaccggttagaaca
atgatcaaaagatgtaaaggtgaggtcaaatattttgaaaattctgtacaagatattgat
ccaatctctaaaaatataactttaaatgatgggaaaataatagattatgattatttagtc
gtcggtgtcggttcaaaaccaactactttcaatatcccaggtgtcattgaaaactcttcc
tttttgaaagaaatttctgatgcaaaagaaattaaatcaaagatttttaaaaatattgaa
ttggcaagtgctctagagaatggtgatccattgaggaaaaaattgttaagctttgtagta
gtaggcggtggccctactggtgtggaatttgccgcggagctgagtgactatattcagcag
gatatcaacaaatggcagccagaattacaaaatgacatctcgattactttagtagaagct
gctccaaatattttgcccagcttcaataaagaattaattcaatatgctgaagaattgtta
agcagtaagggcaaaattcagctgaagttaaatactatagttaaggaagtcgactcaaat
tatttgaaaggtttaatcaaagagcagaatagtgatcatatggagcacattccatatggg
gtgctagtttgggcaacggggaacgccccaagagatatttgtcaatcattgatgtccaaa
ttgaaacaacaggattctaggcgtggtctcttaataaatgataaattgcaattattagga
gcagaagattcaatatttgccataggtgattgtacattccatccaggtcttttcccaact
gcacaagtagcatcgcaggaaggtaaatatttagcaaatattttcaagagactgcataag
atcgaaagattagcatttgaaaagaaaatcagaaaaattgaaattccagatttcaaatac
aaatataaaggtgctttagcttatatcggtcaggataaagcgattgcggatgttgtgacc
tttggtaagacttatccttctgcgggttcattgactttctatttttggaaatccgcatac
ttgacaatgctatcgtcatttagaaacaagatattggtggcattagattggacaaaagtg
tcaatgtttggtagaaactcatcagagtaa

DBGET integrated database retrieval system