KEGG   Kazachstania africana: KAFR_0C06520Help
Entry
KAFR_0C06520      CDS       T02487                                 

Gene name
KAFR0C06520
Definition
(RefSeq) hypothetical protein
  KO
K03252  translation initiation factor 3 subunit C
Organism
kaf  Kazachstania africana
Pathway
kaf03013  RNA transport
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    KAFR_0C06520 (KAFR0C06520)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:kaf03012]
    KAFR_0C06520 (KAFR0C06520)
Translation factors [BR:kaf03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    KAFR_0C06520 (KAFR0C06520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 13885566
NCBI-ProteinID: XP_003956783
UniProt: H2ATE8
Position
3:complement(1310798..1313227)
Genome map
AA seq 809 aa AA seqDB search
MSRFFADTYEYDSATSSSEEDLLSSSEEELLSSSSGEEDNQSDDSLFNESESESDFDSDD
SDSKPYGPDWFKKSAFRKGGSSTANKFLKGNADYSSSDESDAEGKRVVKSAKDKLLDEMT
AVFDKIETAEMSEDWVTILNEFDLISRLLIRAQQQNMGIPRIFIKVVGQVEDLVGSTDQS
EIKNKAVARAYNTVRQRVKKVARENEELMAKLKEDPEFFDKEATVDLESSVADMEATPFG
ANKAKTLASLATATSETSFFTALRIVIDSRGKKNTNQQDLIKILEESLSIAKTSYESIMA
YLTLIPTRFDASSNLSYQPIEQWKASYNDIMALFSILDKNIDTYQVTELALPSESIEDEP
EADQNGIKKILGSIFSFVERLDDEFNKSLLNIDPHSSDYLVRLRDEQSIYNLILRTQLYL
EAILPEEQKERLLSRVFVKRLDHIYYKSERLNTFIETNAWKTIPSNYKSKYIAHDGPVDN
DYIKRLVFTISDVLTKQEDSFLRTRAILYRVYFTALNDDFHTAKEMLLHSNIQADISKSN
SSLQILFNRVVVQLGLSAFQSCLIEECHQVLNELLASTHLKEILGQQNLQRVSSTIDERE
QQCLPYHQHINLDLIDVIFMTCSLIIEIPQMAAYYSGIKVKRLPYSQKSIRRLLEHHDKS
TFQGPPETSRDFVMYAAKSMQKGEWEKSVKYLQNIKAWKFLPNASTVMDSLTERIQIESL
KSYFFTYKRFYCKFSTSTLSTVFDLPTDKIVEVLQSVIDEFEIPAKFDENKAILIVEKGE
EITKLEEVALRLNKEYKINKERLYAPHRS
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtttctttgcagatacttatgaatatgatagtgctacttcgtcttcagaagag
gatttgttatcatcatctgaagaggaattattatcttcttcctccggtgaagaagataat
caatctgatgattctttatttaatgaatctgagtctgaatctgattttgattcagacgat
tctgactcaaaaccatatggtccggactggttcaagaaatctgcattcagaaaaggtgga
agttccactgctaataaatttttaaaaggaaatgcagattattcaagttctgatgaatct
gatgcagaaggtaaaagagtcgtcaaatctgctaaggataaattattagatgaaatgacc
gctgtatttgataaaattgaaactgctgaaatgtctgaagattgggtaaccatattaaat
gaatttgacttaatcagtcgtctattgatcagagctcaacaacaaaacatgggtattcca
agaatcttcatcaaagttgttggtcaagtagaggatttggttggttctaccgatcaatct
gaaatcaaaaataaagcagtggcaagagcttacaacaccgttagacaaagagttaagaaa
gttgccagagaaaatgaagaattaatggccaagttaaaagaagatccagagttctttgat
aaagaagctaccgttgatcttgaatcttctgttgcagacatggaagcaactcctttcggt
gccaacaaggctaagacattagcttctttggctactgccacttccgaaactagtttcttc
accgcactacgtattgtcattgactctagaggtaagaaaaacactaaccaacaagattta
atcaaaatattagaagaatccttatccatcgctaaaacttcctacgaatcaataatggcc
tacttgactttaataccaacaagatttgatgcttcttcaaacttatcatatcaaccaatc
gagcaatggaaagcttcttacaatgacatcatggctttattttctattttagataagaac
attgacacttaccaagtcactgaattggctcttcctagcgaatcaattgaagatgaacca
gaagctgatcaaaatggtatcaagaaaatcttgggttccatcttctctttcgttgaaaga
ttagatgatgaattcaacaaatccttattaaacatcgacccacattcaagtgactactta
gttcgtttgagagatgaacaatctatttacaacttaattttgagaactcaactgtatcta
gaagctatcttgcctgaagaacagaaggaaagattattatcccgtgtcttcgttaagaga
ctagatcatatctattacaagtctgaaagattaaacactttcatcgaaaccaacgcctgg
aaaaccataccatctaactacaaatctaagtacatcgctcacgatggaccagtggataat
gactacattaaaagacttgttttcactatctctgacgttttaactaaacaagaagattct
ttcctacgtactcgtgctatcttataccgtgtctacttcactgcattaaatgacgatttc
catactgccaaggaaatgctactacattctaatatccaagctgatatcagtaagagcaat
tcatccctacaaattttattcaacagggtagttgttcaactaggtctttctgcattccaa
tcatgtttgattgaagaatgccaccaagttttgaatgagttattagcaagcactcatttg
aaagaaatcttgggtcaacaaaacttacaaagagtcagctccactattgacgaacgtgaa
caacaatgcctaccatatcatcaacacataaacttagatttaattgatgtcattttcatg
acatgctctttaatcatcgagattccacaaatggctgcctattactcaggtattaaagtt
aaaaggttgccatactctcaaaaatccatccgtcgtctactagaacatcatgacaaatca
actttccaaggtccaccagagacttccagagattttgtcatgtatgctgctaaatcaatg
caaaagggtgaatgggaaaaatcagtcaagtatctacaaaacatcaaggcctggaaattc
ttaccgaacgcttcaactgttatggactctcttaccgagaggatccaaatcgaatcattg
aagtcatacttcttcacatacaaaagattttactgcaaattttcaactagcactttatca
accgttttcgatttgccaactgacaaaattgtagaagtccttcaatctgtcattgatgaa
tttgaaatcccagctaagtttgatgagaacaaagccatcttgatagttgaaaagggtgaa
gaaattacaaagttagaagaggttgctctaagattgaataaagaatacaaaatcaataaa
gaacgtttatatgctcctcatcgtagttaa

DBGET integrated database retrieval system