KEGG   Kazachstania africana: KAFR_0E02520Help
Entry
KAFR_0E02520      CDS       T02487                                 

Gene name
KAFR0E02520
Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
kaf  Kazachstania africana
Pathway
kaf00020  Citrate cycle (TCA cycle)
kaf00640  Propanoate metabolism
kaf01100  Metabolic pathways
kaf01110  Biosynthesis of secondary metabolites
kaf01130  Biosynthesis of antibiotics
kaf01200  Carbon metabolism
Module
kaf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kaf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KAFR_0E02520 (KAFR0E02520)
   00640 Propanoate metabolism
    KAFR_0E02520 (KAFR0E02520)
Enzymes [BR:kaf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     KAFR_0E02520 (KAFR0E02520)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     KAFR_0E02520 (KAFR0E02520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 IlvN
Motif
Other DBs
NCBI-GeneID: 13883063
NCBI-ProteinID: XP_003957540
UniProt: H2AVK5
Position
5:complement(514784..515779)
Genome map
AA seq 331 aa AA seqDB search
MLRRSFTKSTALRRLLHSQELPYDSTIKNLSLPKDTKVIFQGFTGKQASFHAQISMDYGT
NVVGGTNPKKAGQTHMGKPVFGSVKEAMKETGATASGIFVPPPIAASAIKEAIESEIPLA
VCITEGIPQHDMLYIYQMLKSQTKTRLVGPNCPGIINPATNVRIGIQPPKIFKPGKIGIV
SRSGTLTYEAVQQTTNTDLGQSIVIGMGGDAFPGTDFIDCLRFFLNSDISSGTEGIILLG
EIGGKGEIEAAQFLKEYNYSRSKPLPVASFIAGTVAGQMKGVRMGHSGAIVEGSGTDAES
KKKALRDVGVAVVESPGYLGQALLDEFQKLK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaaggtcatttactaaatctactgcattgcgtcgtttattacactctcaggaa
ctcccttatgatagcactataaagaatctatcattaccaaaggacactaaagtgatattc
cagggattcacaggtaaacaggcaagtttccatgctcagatatcaatggattatggtacg
aacgtcgtgggtggcactaatccaaagaaggcaggtcaaactcacatgggcaaaccagtt
tttggcagtgtaaaagaagctatgaaagagacgggtgctactgcttctgggatctttgtt
cctccaccaatcgccgcctcagctattaaagaagcaattgaaagtgaaattccattagcg
gtgtgtatcacagaaggtataccacaacatgatatgttgtatatctatcaaatgttgaaa
tcacaaactaaaactagattagtggggcccaattgtcccggtattattaaccccgcaaca
aatgtcagaattgggattcaacctccaaagattttcaagccaggtaagattggtattgtt
tctagatcaggcaccttgacttacgaggcagttcaacaaactaccaacacggatcttggt
caaagtatcgtcattggtatgggtggtgacgccttccccgggacagatttcatcgattgc
ttgagattcttcttgaatagtgatatttcaagtggtactgagggtattattttattgggt
gaaatcggtggtaagggtgaaatcgaagccgctcaattcctcaaagaatataactatagt
agatcaaaacccttaccagtggcctcatttatcgctggtactgtggcaggacaaatgaaa
ggtgtaagaatgggtcattctggcgctatcgtagaaggttctggtacagatgccgaatca
aagaagaaagcattaagagacgtgggtgtcgctgtcgttgagtcccctggttatttgggt
caagctttactcgacgaattccaaaaattaaaataa

DBGET integrated database retrieval system