KEGG   Kazachstania africana: KAFR_0H02220Help
Entry
KAFR_0H02220      CDS       T02487                                 

Gene name
KAFR0H02220
Definition
(RefSeq) hypothetical protein
  KO
K00866  choline kinase [EC:2.7.1.32]
Organism
kaf  Kazachstania africana
Pathway
kaf00564  Glycerophospholipid metabolism
kaf01100  Metabolic pathways
Module
kaf_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KAFR_0H02220 (KAFR0H02220)
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     KAFR_0H02220 (KAFR0H02220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Choline_kinase Choline_kin_N APH
Motif
Other DBs
NCBI-GeneID: 13887627
NCBI-ProteinID: XP_003958766
UniProt: H2AZ75
Position
8:complement(422907..424631)
Genome map
AA seq 574 aa AA seqDB search
MVSSSSSVEQTKISKQYKSGSPKRPSLTRKRSSQRLIRTISIETDDEEYLSPGLVVSDAL
TEVHSGSVVNTLPTGELDQIDNKADELPNLTSLKIANENTHKSNDYIEVPFVKASLDATL
PEDYLRNDIWNVIQALKIPRWHNRQNLILDRLKLIKISGAMTNAIFKIEYPKLPSLLLRI
YGSNNDLIIDRDYELEILARLSVRNIGPSLFGCFTNGRFEQFLENSTTLTFQDLRDWKTS
QRIARRMKELHNGVPLLKAEIEDGPVCWKKINNWVNILDSKQWVHNDENIKKVFHCQDWE
FFKKVVKRYYDWLLKSNFYDSKMVFCHNDAQYGNLLFSAPVVEIEDDKSSVSSTKTTASS
LFPSNSNVHLDRIINPPKQERSQDSKLVVIDFEYAGANPAAYDLANHLSEWMYNYTGKEP
HRTLTSEYPTKEQILNFLYSYVSHLRGGSSSSSSSSNIDHEVKYYYNLIIKWRATVQIFW
SLWGVLQSGVLEEKDTEIIFEGTNGEKYIIKEDPDASFNDDVEDHIIEGVSIDTFDYLKY
CSDKIAVFWGDLIKLQIIDESDCMKSKMLDTQLI
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtcctcttcttctgttgagcagacgaagatatcgaaacagtacaaatctggt
agtcccaagagaccttcattgacgaggaaaaggtcgtctcagagacttattaggacaatc
agtatagagacagatgacgaggagtatctttccccaggtttagtggtatcagatgcactg
acagaagtgcactctggctcagtggtgaatacgttacccactggtgaattggaccaaatt
gataataaggctgatgaattaccgaatctgacaagtttgaaaatcgccaatgagaatact
cataagtctaatgattacatcgaggttccctttgttaaggcatcgttggatgccacatta
ccggaagattatttgagaaatgatatatggaacgttattcaagctttaaagatacctaga
tggcataatagacaaaatttaatcttagataggttgaaattgattaagatatcgggtgca
atgacaaatgcgatctttaaaatcgagtatccaaaacttccatcgttgttattaagaatt
tatggttccaataatgatcttatcattgatagggactatgaattagaaattttggctaga
ttatcggttcgtaacattggaccttcattgtttggatgcttcacaaatggcagattcgaa
caatttcttgagaactctacgacattgactttccaggatctaagagattggaaaacatct
caacgtatcgcaagaagaatgaaagaattacacaacggtgttccattactgaaagcagaa
attgaagatggaccagtgtgttggaaaaagattaataattgggtgaatatccttgatagc
aagcagtgggtccataatgatgaaaatattaagaaagtatttcattgtcaagattgggaa
ttctttaaaaaagtggtaaagagatattatgattggttattaaaatctaatttttacgat
tctaaaatggtgttttgtcataacgatgcacaatacggtaatttactgttcagtgccccc
gtcgtagaaatcgaagatgataaaagttctgtatcttccacgaaaacgacagcatcctca
ctttttccatcaaattctaacgttcatctcgatagaattatcaatcccccaaaacaagaa
agaagtcaggactctaaattagtagtcattgatttcgaatacgcaggtgccaatcctgct
gcatacgatctagccaaccatttgagtgagtggatgtacaattacacggggaaagaacct
catagaacgctcacaagtgaatatccaacgaaggaacaaattctcaattttctgtactcc
tacgtttctcaccttcgtggtggcagcagcagtagtagttccagtagcaacatcgatcac
gaggtcaaatactactataatttgataatcaagtggagggccacagtccaaatattctgg
agtctttggggtgttctacaaagtggtgtgctggaagaaaaagatacagaaattatattt
gagggcaccaacggtgaaaaatacattatcaaagaggatccagatgcaagtttcaacgat
gatgttgaagaccacatcatcgaaggcgtcagtatagatacttttgattatttaaagtat
tgtagcgataaaattgcggttttctggggagatttgatcaaattacagataatcgacgag
tctgattgcatgaaaagcaagatgctggatacacagctcatataa

DBGET integrated database retrieval system