KEGG   Kazachstania africana: KAFR_0I00170Help
Entry
KAFR_0I00170      CDS       T02487                                 

Gene name
KAFR0I00170
Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
kaf  Kazachstania africana
Pathway
kaf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KAFR_0I00170 (KAFR0I00170)
Enzymes [BR:kaf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     KAFR_0I00170 (KAFR0I00170)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     KAFR_0I00170 (KAFR0I00170)
    1.1.1.-  
     KAFR_0I00170 (KAFR0I00170)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C Pyr_redox Pyr_redox_3 NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 13883435
NCBI-ProteinID: XP_003958933
UniProt: H2AZJ8
Position
9:34519..35664
Genome map
AA seq 381 aa AA seqDB search
MRGLAYFKKRDIHFTKDLPEPKINVDDEIIIDVSYCGICGSDLHEYLEGPIFMPKDNETN
EISNLSLPLAMGHEMSGIVREVGKNVTKVKKGDKVVVEASSACSDVHRFATGKHYGEEKC
PNCARGYDNCCAYAGFTGLGFIGGGFAEQILVGEQHIVRIPDEIPLDVAALVEPLSVTWH
AAKVGKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEVAQVRRKLAEKMKVEVFDP
SVHGKNTSNELRLLTENKDGFDFAFDCSGLEVTMNTAIHATKCRGTIVNVAVWGSTMEFN
MMDITLQEKTLIGSIGYVVRDFEEVVASIHKRAISIEDCRHLITGKQKIEDGWEHGFMEL
MNHKEKNIKILLTPNNYHELD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtttagcttacttcaaaaagagagatattcattttaccaaggatctaccagag
cccaaaattaatgttgatgacgaaattatcattgacgtcagctactgtgggatatgtggt
tctgatctacatgaatatttagagggcccaatctttatgccaaaagataatgaaacgaac
gagatctccaatctatcattacccttagcaatgggtcacgaaatgagtggtatagtgagg
gaagtgggtaagaacgtcacaaaagtgaaaaagggggacaaggttgtagtagaagccagc
tctgcttgttctgatgttcaccggttcgctactggaaagcattacggtgaggaaaaatgt
cctaactgtgcaagaggttacgataattgttgtgcctatgcaggctttactggcttgggt
tttattggtggtggattcgctgaacaaattctggtaggcgaacaacacattgtgcgtata
ccagacgaaataccattagatgtagcggctttagtagaacccctttcggttacgtggcat
gcagctaaagttggaaaattcgtaaagggaagtacagcattaattctaggttctggtcca
attggtttggctatgattctagttttaaaggcgcttggggctagtaaaattgttgtctca
gaagtagcccaagttagaaggaagttagcagaaaagatgaaggtcgaagtttttgaccca
tcagtacacggcaaaaatacatccaacgaattacgtcttctgacagaaaataaagacggt
ttcgattttgcctttgattgttccggtctagaagttactatgaatacggcaattcatgcg
acaaaatgtagaggcactattgttaatgttgcagtatggggttctacaatggaattcaat
atgatggacatcacattgcaagaaaagaccttaattggttctattggatatgttgtccgc
gatttcgaggaagtagttgccagtattcacaagcgtgcaatttccatagaagattgcaga
catttgattaccggaaagcaaaaaattgaggatggatgggagcatggctttatggaacta
atgaatcataaggaaaaaaatatcaaaatattattaactccaaacaactatcatgaactt
gattag

DBGET integrated database retrieval system