KEGG   Kazachstania africana: KAFR_0K00930Help
Entry
KAFR_0K00930      CDS       T02487                                 

Gene name
KAFR0K00930
Definition
(RefSeq) hypothetical protein
  KO
K15453  tRNA pseudouridine31 synthase [EC:5.4.99.42]
Organism
kaf  Kazachstania africana
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kaf03016]
    KAFR_0K00930 (KAFR0K00930)
Enzymes [BR:kaf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.42  tRNA pseudouridine31 synthase
     KAFR_0K00930 (KAFR0K00930)
Transfer RNA biogenesis [BR:kaf03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    KAFR_0K00930 (KAFR0K00930)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-GeneID: 13886638
NCBI-ProteinID: XP_003959584
UniProt: H2B1E9
Position
11:complement(196655..197779)
Genome map
AA seq 374 aa AA seqDB search
MGIEVCFSSGLRHITPYYATRSSFAKGRWFNKSLLEVLSAEFGTFTRDQYLKEFDLGNYQ
LLRNSERMDPVNTLIRSGDIIVVRQHKHEPPVKQWCLNRQIENFDLLNRVAGMNIVFEDD
DLLVLDKPNGLPIHPTGKFYHNTLIEILKSHNKNVFPTYRLDKVTSGLIILAKSSGVAKM
IQDKIKTRNVTKLYLARVKGKFPGTEPVKMDSPIYTIDPKRRFPAGLTTSRDATTEFSLF
KYLPDVNESVVLCRPLTGRTHQIRIHLLRLGYPIVNDPLYCPEKSSFPLRLRFIRNILKW
EDSVEPVPQIFDAIINEYEDVRLKKSQNLEKCSECGSFEIKDSPIEELVIWLHAWKYSID
EASTFETDLPTWAC
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggcattgaagtatgtttctcgagcgggctaagacatattacaccttactatgccact
agatcgtcatttgctaagggtagatggttcaacaagtcacttttagaagtgctgagtgct
gaattcgggacattcacaagagaccaatatttgaaggaatttgatcttggtaactaccaa
ttgctaagaaattcggagagaatggacccagtaaatacattgataaggagtggggatatt
attgtggttagacagcataaacatgagcctcctgtcaaacaatggtgtctgaatcgacaa
attgagaatttcgatctattaaatcgagttgctggtatgaatatagtgtttgaggatgac
gatttgttggtcttagataaaccaaatggactgccaatccatccaactgggaagttctat
cataatacgttgattgagattttgaaatcacataataaaaatgtcttccctacatacagg
ttagataaagttacttctgggttgataatcctggcaaaatcaagcggagtggctaagatg
attcaggataagattaagactaggaatgtaaccaagttatatcttgcacgagtcaaaggt
aagtttcctggtaccgagcctgttaaaatggactcacctatctatacaatagatcccaag
aggaggttccccgctgggctcaccacgtcaagagatgctaccaccgaattttcactattt
aaatatttaccagatgtcaacgaaagtgtggttctttgtagaccgttgacaggtagaacg
catcaaattagaatccatctattaagactcggatatcctattgtcaatgatccactttat
tgtcccgaaaagtcttcattccctttgagactacgatttatacgaaatatacttaaatgg
gaggattctgtggaacctgttcctcagatatttgacgctattataaatgaatatgaagat
gtaagactcaagaaaagtcaaaatttagaaaaatgcagtgaatgtggttcatttgagatc
aaagattcacccattgaggaattagttatatggctacatgcatggaagtattctattgat
gaggcatcaacttttgaaacggatttgccaacatgggcgtgttaa

DBGET integrated database retrieval system