KEGG   Kazachstania africana: KAFR_0K00960Help
Entry
KAFR_0K00960      CDS       T02487                                 

Gene name
KAFR0K00960
Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
kaf  Kazachstania africana
Pathway
kaf00450  Selenocompound metabolism
kaf00970  Aminoacyl-tRNA biosynthesis
kaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    KAFR_0K00960 (KAFR0K00960)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KAFR_0K00960 (KAFR0K00960)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kaf01007]
    KAFR_0K00960 (KAFR0K00960)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kaf03016]
    KAFR_0K00960 (KAFR0K00960)
Enzymes [BR:kaf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     KAFR_0K00960 (KAFR0K00960)
Amino acid related enzymes [BR:kaf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   KAFR_0K00960 (KAFR0K00960)
Transfer RNA biogenesis [BR:kaf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KAFR_0K00960 (KAFR0K00960)
 Prokaryotic type
   Other AARSs
    KAFR_0K00960 (KAFR0K00960)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f YqaH DUF4568
Motif
Other DBs
NCBI-GeneID: 13886641
NCBI-ProteinID: XP_003959587
UniProt: H2B1F2
Position
11:complement(202097..203686)
Genome map
AA seq 529 aa AA seqDB search
MINLRLYSSVSHVTTPIFYPNAKPHLGHLYSSLLCDVYHRWMQLNNAKSLFTTGTDEHGL
KIQIESERQKYKTPLDFVNKLYPEFIRLDNFYNISFTNFIRTTNSDHIANVTKLWELCNK
NKLIYKGTHKGWYSISDETFYPESKVIKNPNEPNKFINTESQNEVVYQSETNYFFKLSQF
QDRLIKFFEENPHFIQPRSKHHQLLNYLKSTELKDLSISRPISRLNWGVKVPNDDSQIIY
VWFDALTNYITSIGGISNVNSLEWKNTSHVIGKDIMKFHSIYWPCFLWGAELPLPRRIII
HNHWISNGMKMSKSIGNVVEPIEIGKKYGTDIIRWYVLENSNLEDDSNFVEQDVAHLKEL
FIGKWGNLINRCCGTKFNISRSVQRFHSENLSQEYNEIIKDDNLRTEVSNLLNSLKELKI
VMKEAIENFDYAQILKLIWPIINHTNAIVQISKPWERPELEQDLIIFTCIEVCRILAILC
QPIIPNISEKFLDRIDVLPSKRSLSFAEIGSDNNYGSNSNSKGRELPIS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacctaagactttactctagtgtgtcacacgttactacaccaatcttttatcct
aatgcaaaacctcatttgggccacttatattcaagcctcttatgcgacgtttaccacagg
tggatgcaattgaacaacgccaagtcactcttcaccacaggaaccgatgaacatgggttg
aagattcaaattgaaagtgaaaggcaaaaatataagactccattagattttgtcaataaa
ttatacccagaatttattagattggataacttctacaacatttcattcactaattttatt
cgaaccacaaatagtgatcatattgcaaacgtaacaaagttatgggaactatgcaataag
aataagctgatttataaaggtactcacaagggatggtactcaatctccgatgaaacattc
tatccagaatcaaaagtcatcaaaaatcctaatgaacctaacaaatttatcaatactgaa
tcgcaaaatgaagtagtatatcaatctgagacaaattatttcttcaaattgtctcaattc
caggatagattgataaaatttttcgaagaaaacccacactttatacaaccaagatcaaaa
catcatcaacttttgaattacttgaagtccacagaactgaaagatctatcaatatcaaga
ccaatatccagattgaattggggtgttaaagttccaaacgatgattcccaaatcatatat
gtctggtttgatgccctaacaaattatattacttcaattggtgggatcagtaacgtcaat
tctcttgaatggaagaacacatctcatgtaatcgggaaagatataatgaaattccattct
atctattggccttgctttctttggggcgccgaattaccacttccaagacgtataataata
cataaccattggatatctaatggaatgaaaatgtcgaagagtattggaaacgttgtagag
ccaattgaaattggcaaaaaatatggaacggatataattagatggtacgtattggaaaat
tcaaatctagaagatgattccaattttgtagaacaagatgtagcacacctgaaagagctt
tttattggtaaatgggggaatttaatcaacagatgttgcggtacaaaatttaatatatca
aggagtgtacagcggttccactctgaaaacttaagtcaagaatacaatgaaattatcaaa
gatgataatttaagaactgaagtgtctaacctgctaaactcgttgaaggaattaaaaatt
gtcatgaaagaggcaattgaaaactttgattacgctcagattctgaaacttatttggcca
ataatcaaccatactaatgctatcgtacaaattagtaaaccttgggaaaggcctgaactt
gagcaggatttgatcatttttacttgcattgaagtttgtcgtattttagcaattttatgt
caaccaataataccaaatatatccgaaaaatttctggatagaattgatgtattacctagc
aaaagatctctgagttttgctgaaatcggtagtgacaataattatggatcaaattcaaac
agtaaaggtagggaattacccatatcgtaa

DBGET integrated database retrieval system