KEGG   Kutzneria albida: KALB_1434Help
Entry
KALB_1434         CDS       T03039                                 

Definition
(GenBank) cytochrome P450
  KO
K17476  pentalenolactone synthase [EC:1.14.19.8]
Organism
kal  Kutzneria albida
Pathway
kal01100  Metabolic pathways
kal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kal00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various secondary metabolites - part 1
    KALB_1434
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:kal00199]
    KALB_1434
Enzymes [BR:kal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.8  pentalenolactone synthase
     KALB_1434
Cytochrome P450 [BR:kal00199]
 Cytochrome P450, bacteria type
  CYP161 family
   KALB_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: AHH94807
UniProt: W5W1S7
Position
1525326..1526507
Genome map
AA seq 393 aa AA seqDB search
MTDLPSLPFATTGVLDLPPELLRLQDNAPISRVRTMAGDEAWLVSRYEDVKALFADERLG
RSHPRPEKAAKVTNSAILGGASGDYDTEDHDHAAMRAMLVPAFSPRRMRAMRPLIERLVE
DLLDAMQAKQPPVDLHTELAEPLPVLVICELLGVPYADRAEFRALSDAAADTVNAQSSAT
AWQGLVEYMAGLIAGKRTQPGDDLLSDLIAAHGDKVADRDLAALGAGLLFAGHETTLVRI
DFGTVLLLSNPDQREAALRGDSELAATVEEVLRRSSNGVGGLPRYAREDIQVGDVTIAAG
EAVLLSIGGANHDAQAFPEPTRFDAGRASNQHLAFGHGARYCIGASLARIELQVVFAALL
RRFPTLRLAVPVDQLELRTGRLGGGLVSVPVAW
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccttccgtccctgccgttcgccaccacgggcgtgctcgacctgccaccggag
ttgttgcggttgcaggacaacgcgccgatcagccgggtgcgcaccatggccggcgacgag
gcctggctggtcagcaggtacgaggacgtcaaggccctgttcgccgacgaacggctgggg
cgctcgcatccgcgacccgagaaagcggccaaggtcaccaactcggcgatcctgggcggg
gccagcggggactacgacaccgaggaccacgaccacgccgcgatgcgggcgatgctggtg
cccgccttctccccgcgccggatgcgcgcgatgcgcccgctgatcgagcgcctggtcgag
gacctgctcgacgccatgcaggccaagcaaccgccggtggacctgcacaccgaactggcc
gagccgctgcccgtgctggtgatctgcgaactgctcggtgtgccctacgccgaccgggcc
gagttccgcgcgctgtccgatgccgctgccgacaccgtcaacgcccagtcctcggccacc
gcctggcaggggctcgtcgagtacatggccgggctgatcgcgggcaagcgcacccagccc
ggtgacgacctgctctccgacctgatcgccgcgcacggggacaaggtcgccgacagggac
ctggccgctctcggcgccgggctgctgttcgccgggcacgagaccaccctggtgcgcatc
gacttcggcaccgtgctgctgctgagtaaccctgaccagcgtgaggccgcactgcgcggg
gactcggagctggcggccaccgtggaggaggtgctgcgccgcagcagcaacggtgtcggt
ggcctgccccggtacgcccgcgaggacatccaggtcggtgacgtgaccatcgcggcgggc
gaggcagtgctgctcagcatcggtggcgccaaccacgacgcacaggcgttccccgagccc
acccgcttcgacgcgggccgggcgagcaaccagcacctggccttcgggcacggggcgcgc
tactgcatcggtgcgagcctggctcgcattgagctgcaggtggtgttcgccgcactgctg
cgccggttccccaccctgcggctggccgtgccggtggaccaactggagctgcgcaccggc
aggctcggcggcgggctggtctcggtaccggtcgcctggtga

DBGET integrated database retrieval system