KEGG   Kutzneria albida: KALB_2572Help
Entry
KALB_2572         CDS       T03039                                 

Definition
(GenBank) beta-galactosidase
Organism
kal  Kutzneria albida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_35 BetaGal_dom4_5 NPCBM BetaGal_dom2 BetaGal_dom3 Glyco_hydro_42 NPCBM_assoc Cellulase CBM60 Glyco_hydro_2_N
Motif
Other DBs
NCBI-ProteinID: AHH95940
UniProt: W5W591
Position
complement(2797131..2800811)
Genome map
AA seq 1226 aa AA seqDB search
MTLPVSLRRARVLTLLVAAALVLSFLHPGPTPAAQAAEQPRAQHSVSYDGYSFLVDGKRT
YLWSGEFHYYRLPSVDLWRDVLQKMKAAGFNATSLYFDWGYHSPKEGSYDFTGVRDVDKL
LDIAAEVGLYVIARPGPYINAEVDGGGFPTWLSTRPGNTRTADPAYLKYSDEWQGRIDQI
LARHQLTDGRGTVIAYQVENEYYNGKPDGRTYMAHLEAKARADGIKVPLTGNNNGTFNSG
DGALDVDGADSYPQGFDCSNPTKWNGVPDISYDHVPGKPLYTAEFQGGAFDPWGGPGYGK
CAQLINDQFADVFYKQNIAVGATAQSFYMLYGGTSWGWSAIPQNYTSYDYGAAITESRQL
DAKYAQDKLIGYFTQAVAPLTKTDKLAVAQPESPEIVDTARSNPDTGTQFHVVRHKDSTS
TAKTSTHLVLDLGTAGRYPVVPQDPKATITLDGRQSKILVAGYDLGASPMRYSTSEIMTN
ATIGDRDVAVLYGDRGTVGETVLHYAAKPTVTVLDGTAQSTWDAQRGDLRLDYDHQGLTR
VLITGGARPLLLLLADKDSAKSFWRLDTVSGPVLVRGTHLLRTATGEGDRLALTGDTDTE
GGAEVFTAAKSLSWNGNPVQGQRTPSGTLAVTLPTAKPVSVPALDNWRHQQESPESQPGF
DDSSWPVATKTTTNSKTTPASLPVLFADDYDFHTGNTWYRGRFHSSGKETGLTLSSQSGG
PAGTVSVWLNGRFLGSSADARHEFAFPAGTVLGQGDNVVSVLTVNMGHDEDYNPSNGNKS
ARGLLGAALTGAPLTPITWRLQGVRGGEDGLDPVRGPLNTGGLYGERAGWSLPGYPDQSW
ARVSLPANDTTPGVSWYRTSATLNLPQGQDTSIGLEIADSPSRHYRALLFVNGWQLGQYV
NDTGPQHSFPVPNGVLNPHGANSIAIAVWNTDGSTGGLGKVRLVNYGSYASPLTVALNPS
PGYDARRYAMPESSVRVALDTPGTVTSGQQTTVTATVTVPQGKRPISEVTAALALPEGWT
AGAATPPVVHTIGSGQSVKFTVPVKVGPVRQVNAVSAKVRYREGSAGDTRVLGMVPPAPP
AGVNQVSALPWLSASNGWGPIERDTSVGEDKPGDGRPITLRGKVFQHGLGTNAPSDAQFY
LAGRCDRFTATVGVDDETNGAGSVSFRVLVDGQVLGTTPVLTGTSPTASFDLATTGGQVL
DLVVDEAGDGPGHDHGDWAEPVLTCH
NT seq 3681 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgccggtttcgcttcggcgcgcgcgtgtgctgaccctgctggtcgccgcggcg
ctggtcctgtccttcctccaccccggccccaccccggccgcgcaggccgctgagcagccg
agggcccagcacagcgtcagctacgacgggtactccttcctcgtcgacggcaagcggacc
tacctgtggtccggcgagttccactactaccggctgcccagcgtggacctgtggcgcgac
gtgctgcagaagatgaaggctgcgggcttcaacgcgacctcgctgtacttcgactggggc
taccactcgccgaaggagggcagctacgacttcaccggggtgcgcgacgtggacaagctg
ctcgacatcgcggcggaggtcgggctgtacgtgatcgcacggcccgggccctacatcaac
gcggaggtggacggcgggggcttccccacctggctgagcaccaggccgggcaacacgcgc
accgccgacccggcctacctgaagtactccgacgagtggcaggggcgcatcgaccagatc
ctggccaggcaccagctcaccgacgggcgcggcacggtgatcgcctaccaggtggagaac
gagtactacaacggcaagcccgacggccgcacctacatggcgcacctggaggccaaggcg
cgggccgacggcatcaaggtcccgctgaccggcaacaacaacggcacgttcaactccggg
gacggggcgctggacgtggacggggccgactcctacccgcagggcttcgactgctcgaac
ccgacgaagtggaacggggtccccgacatctcctacgaccacgtgccgggaaaaccgctc
tacaccgcggagttccagggcggcgcgttcgacccgtggggcggtcccggttacggcaag
tgcgcccagctgatcaacgaccagttcgcggacgtgttctacaagcagaacatcgcggtg
ggcgccaccgcgcagagcttctacatgctctacggcgggacctcctggggctggagcgcg
atcccgcagaactacacctcctacgactacggcgcggcgatcaccgagtcgcggcagctg
gacgccaagtacgcgcaggacaagctgatcggctacttcacccaggccgtcgccccgctg
accaagaccgacaagctggccgtcgcgcagcccgagtcgccggagatcgtggacaccgct
cggtccaatccggacaccgggacccagttccacgtggtgcggcacaaggactcgacctcg
accgcgaagacgagcacgcacctcgtgctggacctcggcaccgcgggcaggtacccggtg
gtgccgcaggaccccaaggccacgatcaccctggacggccgtcagtcgaagatcctcgtg
gcgggctacgacctcggcgcgagcccgatgcggtactccacctcggagatcatgaccaac
gcgacgatcggcgaccgcgacgtggcggtgctctacggcgaccgcggcacggtgggcgag
accgtgctgcactacgccgccaagcccacggtgacggtgctcgacgggacggctcagtcc
acttgggacgctcaacgcggtgatctccggctggactacgaccaccagggcctcacccgc
gtgctgatcaccggcggggcacgaccgctcctgctgctgctcgccgacaaggacagcgcc
aagtcgttctggcgactggacaccgtgagcggcccggtgctcgtgcgcggcacgcacctg
ctgcgcaccgccaccggcgagggtgatcgcctcgcgctcaccggggacaccgacaccgag
ggtggtgccgaggtgttcaccgcggcgaagtccctgtcctggaacggcaatccggttcag
ggtcagcgcacgccgagcggcacgctggcggtgaccctgcccaccgcgaagccggtcagc
gtgcccgcactggacaactggcggcaccagcaggagtcgccggagagccagccgggcttc
gacgactcgagctggccggtggccaccaagaccaccacgaacagcaagaccaccccggcc
agtctgccggtgctgttcgccgacgactacgacttccacaccggcaacacctggtaccga
ggccggttccactcctccggcaaggaaaccggcctcaccctgtccagccagagcggtgga
ccggcgggcaccgtgtcggtctggctcaacggccggttcctcggctcctcagccgacgcc
aggcacgagttcgccttccctgcgggcacggtgctcggtcagggcgacaacgtggtctcg
gtgctgaccgtcaacatgggacatgacgaggactacaacccgagtaacggcaacaagtcc
gcacgcgggctgctcggtgccgcgctgaccggcgccccgctgacgccgatcacctggcgc
ctacagggcgtccgcggcggcgaggacggcctggacccggtgcgcggtccgctcaacacc
ggcgggctctacggggagcgcgccgggtggtcgctgccgggctacccggaccagtcctgg
gcccgggtctcgttgcccgccaacgacacgaccccgggcgtgtcctggtaccgcacgagc
gccacgctgaacctgccgcagggccaggacacctcgatcgggctggagatcgcggacagc
ccgtcccgccactaccgggcactgttgttcgtcaacggctggcagctgggccagtacgtc
aacgacaccgggccgcagcacagctttcccgtccccaacggggtgctgaacccgcacggg
gccaacagcatcgccatcgccgtgtggaacaccgacggcagcaccggcggcctcggcaag
gtccgactggtcaactacggcagctacgcctcaccgctgacggtggcgctcaacccgagc
cccggctacgacgcccgccgctacgcgatgcccgagtcctcggtgcgcgtggcactggac
acgccgggcaccgtgacctcagggcagcagacgacggtcaccgcgacagtgaccgtgccc
caaggaaaacggcccatttccgaggtcacggccgcactggcgctgcccgagggctggacg
gccggtgccgcgacgccgccggtggtgcacacgatcggcagcggtcagtcggtgaagttc
accgtgccggtcaaggtcggtccggtgcggcaggtgaacgccgtgtccgcgaaggtccgg
taccgggagggttcggccggggacacccgtgtccttggcatggtcccgcccgcgccacca
gcgggggtcaaccaggtcagcgccctgccctggctgtccgcgagcaacggctggggcccg
atcgagcgggacaccagcgtcggtgaggacaaaccgggtgacggtcggccgatcaccttg
cggggcaaggtgttccagcacggtctgggcaccaacgcccccagcgacgcgcagttctac
ctggcaggccgttgcgaccggttcaccgccacggtcggcgtggacgacgagaccaacggc
gctggctcggtgtcgttccgggtcctggtcgacggccaggtgctcggcacgaccccggtg
ctgaccggcacctcgccgaccgcctcgttcgacctggcgaccaccggcgggcaggtgctg
gacctggtcgtggacgaggccggtgacggccctggccacgatcacggggactgggccgag
ccggtgctgacctgtcactga

DBGET integrated database retrieval system