KEGG   Kutzneria albida: KALB_4347Help
Entry
KALB_4347         CDS       T03039                                 

Definition
(GenBank) hypothetical protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
kal  Kutzneria albida
Pathway
kal00330  Arginine and proline metabolism
kal00360  Phenylalanine metabolism
kal00380  Tryptophan metabolism
kal00627  Aminobenzoate degradation
kal00643  Styrene degradation
kal01100  Metabolic pathways
kal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    KALB_4347
   00360 Phenylalanine metabolism
    KALB_4347
   00380 Tryptophan metabolism
    KALB_4347
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KALB_4347
   00643 Styrene degradation
    KALB_4347
Enzymes [BR:kal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     KALB_4347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHH97709
UniProt: W5WHS5
Position
complement(4882708..4884045)
Genome map
AA seq 445 aa AA seqDB search
MGVAELVRSGEVSAAEVAGAAVARAELVDPKLRAVAFPAYDRVSAAGGLLAGVPTFVKDN
TDVRGLPSGHGSAALRPGPAKRDAGFARQYLSSGVTVLGKSRLPEFGFNASTEFAGAEPT
RNPWHTAYSAGASSGGAAALVAAGVVPIAHANDGGGSIRIPAACCGLVGLKPTRGRLVAN
EQGRSLPIDLVSDGVVSRSVRDQAAFYAAAERYWRNPRLPELGLVEGPGRRRLRIGLVVD
SPAGVRACPRTAEVVAETVSVLEGLGHRVEPVVVPIDGRFVADFTAYWGMLSFLVSVTGK
VVLDRSFQASRMDGLSQGLRGLFRSRLLAAPGMLYRLSRVRRDYARMFERVDLVLSPVLA
HVTPLLGHLSPTVPFEELLTRLQSYVAYTPLNNVSGGPAISVPMGATAEGLPVGVQFSAV
HGAERTLLELAFELEAARPWRRIQD
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtgggggtcgccgagctggtgcggtccggtgaggtcagtgcggctgaggtggccggggcc
gcggtggcgcgtgccgagctggtcgaccccaagctgcgggcggtggcgttccctgcctat
gaccgggtttcggcggctggcgggttgctggctggggtgccgacgttcgtgaaggacaac
accgatgtacgcgggctgccttcggggcatggttcggcggcgctgcggcccgggcctgcg
aagcgggacgccggtttcgcgcggcagtacctgagttcgggtgtgacggtgctgggcaag
agccggttgccggagttcgggttcaacgcgtcgacggagttcgctggtgctgagccgact
cgcaatccgtggcacacggcgtactccgcgggggcgtcctcgggtggtgccgcggctttg
gtggctgccggggtggtgccgatcgcgcacgccaacgacggtggtgggtcgatccgcatt
ccggcggcgtgttgcgggttggtggggttgaagccgactcggggccggttggtggccaac
gagcagggcaggtcgttgccgatcgacctggtgtcggacggggtggtgtcgcggtcggtg
cgggaccaggcggcgttctacgcggctgcggagcggtactggcgcaatccgcggttgccg
gagttggggttggtggaggggcctgggcggcggcggttgcggatcgggttggtggtcgac
tcccccgctggtgtgcgggcttgtcctcggacggctgaggtggtggcggagaccgtttcg
gtgttggaggggttggggcaccgggtggagccggtggtggtcccgatcgacgggcggttc
gtggcggacttcacggcgtactggggcatgttgtcgttcctggtgtcggtgacgggcaag
gtggtgctggatcggtccttccaggcgagccggatggacgggttgagccaggggctgcgc
gggctgttccggtccaggttgttggcggcgccgggcatgctgtaccggttgtcgcgggtg
cggcgggactacgcgcggatgttcgagcgggtggacctggtgctgtcgccggtgctggcg
cacgtgactccgttgctggggcacctgagtccgactgtgccgttcgaggagttgttgacg
cggttgcagtcctatgtggcctacacgccgttgaacaacgtgtcgggcggtccggcgatc
tcggtgccgatgggtgcgacggcggagggactacccgttggggtgcagttctcggcggtg
cacggggcggagcgcaccctgttggagctggccttcgagctggaggcggcacgtccttgg
cggcgtatccaggactga

DBGET integrated database retrieval system