KEGG   Kutzneria albida: KALB_5880Help
Entry
KALB_5880         CDS       T03039                                 

Definition
(GenBank) hypothetical protein
  KO
K22213  6-methylsalicylate decarboxylase [EC:4.1.1.52]
Organism
kal  Kutzneria albida
Brite
KEGG Orthology (KO) [BR:kal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KALB_5880
Enzymes [BR:kal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.52  6-methylsalicylate decarboxylase
     KALB_5880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: AHH99241
UniProt: W5WF87
Position
complement(6540299..6541246)
Genome map
AA seq 315 aa AA seqDB search
MGGRIDTHHHVVPPAYRDWLRSQGLTAGGMPVPNWSAAADIALQDSQGIGTAILSVSTPG
THLGSDEQARDWARAVNEFTAEQVKDRPDRFGHFATLPLPDVDGALAETARAFDELGADG
IVLLSNHRGTYLGEPAFEPLMAELDRRSAVVFVHPGIPPYQPVPGVPFYAADFLLDSVRA
AMSLVLSGTVRRYPGIRFILSHGGGFLPYAADRIAVTLEHHQRVQGADPVLDHAAVLAQL
REFHFDTALAANHATLANLLAFADPGRITFGSDWPYAPEAGVRHVTAEFDSAPLDPVQRA
AINRDNALNLFPRLA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtcgcatcgacacccaccaccacgtcgtgcccccggcgtaccgggactggctg
cggtcccaggggctcaccgcgggcggcatgcccgtcccgaactggagcgcggcggccgac
atcgccctccaggacagccagggcatcggcaccgcgatcctgtcggtgtccaccccgggc
acccacctcggttcggacgagcaggcccgcgactgggcccgtgcggtcaacgagttcacc
gccgagcaggtcaaggaccgccccgaccggttcgggcacttcgccaccctgccgctgccc
gacgtggacggcgcgctggccgagaccgcccgcgccttcgacgagctgggcgccgacggg
atcgtgctgctgagcaaccaccgcggcacctacctgggcgagcccgcgttcgagccgctc
atggccgagctggacaggcggtcggcggtcgtgttcgtgcacccgggcatcccgccctac
cagccggtgcccggagttcccttctacgcggcggacttcctgctcgacagcgtgcgcgcg
gcgatgagcctggtgctcagcggcaccgtgcgccgctaccccgggatcaggttcatcctc
tcccacggcggcgggttcctgccctacgcggcggaccgcatcgccgtcaccctggagcac
caccaacgagtccagggcgccgacccggtcctcgaccacgccgccgtcctggcccagttg
cgcgagttccacttcgacacggcgctggccgccaaccacgcgaccctggccaacctgctc
gccttcgccgaccccggccggatcaccttcggcagcgactggccctacgcgcccgaggcc
ggggtccggcacgtcaccgccgagttcgacagcgcgccgctggaccccgtgcagcgtgcg
gcgatcaaccgggacaacgccctgaacctgttcccgcggttggcctga

DBGET integrated database retrieval system