KEGG   Kutzneria albida: KALB_6635Help
Entry
KALB_6635         CDS       T03039                                 

Definition
(GenBank) hypothetical protein
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
kal  Kutzneria albida
Pathway
kal00760  Nicotinate and nicotinamide metabolism
kal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KALB_6635
Enzymes [BR:kal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     KALB_6635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX zf-NADH-PPase NUDIX-like MerR RNA_pol_inhib
Motif
Other DBs
NCBI-ProteinID: AHH99994
UniProt: W5WP83
Position
complement(7551908..7552744)
Genome map
AA seq 278 aa AA seqDB search
MSESAIAYTGLGLDRAGARRRDPAWLGEQRARQDVRLLRFWQDRYAPDSQVVAGQEVFLG
LDGEVPVFAVDLPEAADTVDVRSLFGTVPADQAAALVCAKGLLHWNRHQRFCGTCGAATE
SREGGHLRVCQGPHCGRLLFPRIEPAVIALVEHEDRCLLARHRGAGPTAFATLAGFVEIG
EALEEAVRREVAEESGVTVDTVTYLGSQPWPFPSGLMIGFRARAVSGHIAVDHEELEEAR
WFTREEVLAGGHTGRVDSIGAHLIEQWVKTPGLAPSGA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgagtcggcgatcgcctacaccggactggggctggaccgggccggggcgcggcgg
cgcgatcccgcgtggctcggggaacaacgcgcccggcaggacgtgcggctgctcaggttc
tggcaggaccgctacgcgcccgactcacaagtcgttgcgggacaagaggttttcctcgga
ctggacggcgaggtcccggtgttcgcggtggacctgcccgaggcggccgacacggtggac
gtgcgctccctgttcggcacggtgcccgccgaccaggcggcggccctggtctgcgccaag
ggcctgctgcactggaaccggcaccagcgcttctgcggaacctgtggtgccgcaacggaa
agccgtgagggcggccacctgagggtgtgccagggcccgcactgcgggcggctgctgttc
ccgcgcatcgagcccgcggtgatcgcgctggtggagcacgaggaccgctgcctgctcgcc
aggcaccgcggcgcggggccgaccgccttcgccacgctggcgggtttcgtggagatcggt
gaggccctggaggaggcggtgcgccgcgaggtggccgaggagtcgggggtcactgtggac
accgtgacctacctcggctcgcagccctggccgttcccctcggggctgatgatcggcttc
cgcgcgcgggccgtgagcggacacatcgccgtggaccacgaggaactcgaggaggcgagg
tggttcacccgcgaggaggtgctcgcgggcgggcacaccgggcgggtggactccatcggc
gcccacttgatcgagcaatgggtgaaaacccccggattggccccgagcggagcgtga

DBGET integrated database retrieval system