KEGG   Kitasatospora aureofaciens: B6264_00280Help
Entry
B6264_00280       CDS       T05021                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kau  Kitasatospora aureofaciens
Pathway
kau00260  Glycine, serine and threonine metabolism
kau01100  Metabolic pathways
kau01110  Biosynthesis of secondary metabolites
kau01120  Microbial metabolism in diverse environments
kau01130  Biosynthesis of antibiotics
kau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B6264_00280
Enzymes [BR:kau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     B6264_00280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 WW
Motif
Other DBs
NCBI-ProteinID: ARF77567
UniProt: A0A1E7ND11
Position
complement(67787..68863)
Genome map
AA seq 358 aa AA seqDB search
MTDLTRTDAVRRHDPAVRGFASDNYAGVHPEVLAAITLANGGHQISYGEDDYTAHLQDVF
RRHFGDKAEAYPVFNGTGANVVALQALLPRWGAVVCADTAHIHVDEGGAPEKMGGIKLHT
VSTPDGKLTPELLDRQAFGFGDEHRAQPLAVSITQSTELGTLYTIDEIRAVVDHAHQLGM
LVHMDGSRLANAAASLGQPMRAFTTDLGVDVLSFGGTKNGLLLGEVVVVLNPERVRNIKY
LRKTSMQLASKMRFVSVQFEALLAGDLYLRNAGHANAMASRLEAAVRKIDGVEVVRPVQA
NAVFAILPREVSERLQKRYRFYFWNEHTGEVRWMCSYDTTEADIDAFAAAIAEEMGRA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctcacccgtacggacgcggtacggcggcacgaccccgccgtccgcggcttc
gccagcgacaactacgccggcgtgcaccccgaggtcctcgccgcgatcaccctggccaac
ggaggccaccagatctcctacggcgaggacgactacacggcgcacctccaggacgtcttc
cgccgccacttcggcgacaaggccgaggcctacccggtgttcaacggcaccggcgccaac
gtggtcgccctccaggcgctgctgccccgctggggcgccgtggtctgcgccgacaccgcc
cacatccacgtggacgagggcggcgccccggagaagatgggcggcatcaagctgcacacc
gtctccaccccggacggcaagctcacccccgagctgctcgaccgccaggccttcggcttc
ggtgacgagcaccgcgcgcagccgctcgcggtctccatcacccagagcaccgagctcggc
accctctacacgatcgacgagatccgcgcggtcgtcgatcacgctcaccagctcggcatg
ctggtccacatggacggctcgcgactggcgaacgcggccgcctcgctcggccagccgatg
cgggccttcacgacggacctcggcgtcgacgtgctgtccttcggcggcacgaagaacggc
ctgctgctcggcgaggtcgtggtggtgctcaacccggagcgggtgcgcaacatcaagtac
ctgcgcaagacctcgatgcagctcgcgtcgaagatgcgcttcgtctccgtccagttcgag
gccctgctcgcgggggacctctacctgcgcaacgccggccacgccaacgcgatggccagc
cggctggaggcggcggtccggaagatcgacggcgtcgaggtcgtccgcccggtccaggcc
aacgcggtgttcgcgatcctcccgcgcgaggtgagcgagcggctgcagaagcgttaccgc
ttctacttctggaacgagcacaccggtgaggtgcgctggatgtgttcgtacgacaccacg
gaggccgacatcgacgccttcgcggcggccatcgccgaggagatgggccgcgcctga

DBGET integrated database retrieval system