KEGG   Kitasatospora aureofaciens: B6264_10070Help
Entry
B6264_10070       CDS       T05021                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
kau  Kitasatospora aureofaciens
Pathway
kau00310  Lysine degradation
kau01100  Metabolic pathways
kau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    B6264_10070
Enzymes [BR:kau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     B6264_10070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Thi4 Pyr_redox_2 FAD_binding_3 FAD_binding_2 Lycopene_cycl Pyr_redox Trp_halogenase Mqo HI0933_like Pyr_redox_3 NAD_binding_7 FAD_oxidored K_oxygenase NAD_binding_9 GIDA
Motif
Other DBs
NCBI-ProteinID: ARF79217
UniProt: A0A1E7N139
Position
2341014..2342249
Genome map
AA seq 411 aa AA seqDB search
MADEFDVVVVGGGIVGLATAYALTRARTGLRIAVLEKENGFAAHQTGRNSGVIHSGVYYR
PGSYKARFAVAGAAELVGFCREHGIPHEVTGKLIVATDDAELPRLAVLAERGRANGIPVT
ELDRAGIARYEPEVAGRAGLHVGTTGICDFPAVATTYARLAREAGAELRPGTEVRTLVRR
RDRVTVGTAAGELRCRVLVNCAGLHSDRIARLAGDDPGVRIVPFRGEYYELVEQRRALVR
GLVYPVPDPAFPFLGVHLTRGIHGDVHVGPNAVPALAREGYAWHTVRPRDLAGTLAFPGT
WRILRRHWRYEVGELHRSLSKRAFTTAVQRLLPAVTAADLVPAPAGVRAQAVARDGSLLD
DFAFAGFDPEDRHSPRRAVHVLNAPSPAATASLPIGREVARRALAALEAGG
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtggcggacgagttcgatgtcgtggtggtcggcggcgggatcgtcgggctggccacggcc
tacgccctgaccagggcgcgcaccggcctgcggatcgcggtgctggagaaggagaacggc
ttcgccgcgcaccagaccgggcgcaacagcggggtgatccacagcggcgtgtactaccgc
cccggctcgtacaaggcccggttcgccgtcgcgggcgccgccgagctggtcgggttctgc
cgcgagcacggcatcccgcacgaggtcaccggcaagctgatcgtggcgaccgacgacgcc
gaactgccccggctggcggtgctggccgagcgggggcgggcgaacgggatcccggtcacc
gagctggaccgggccgggatcgcccggtacgaaccggaggtcgcggggcgggctgggctg
cacgtgggcacgaccggcatctgcgacttcccggccgtcgcgacgacgtacgcccggctg
gcccgggaggcgggtgccgaactgcggcccggcaccgaggtgcggacgctcgtccgccgc
cgggaccgggtcacggtcggcacggccgccggggaactgcgctgccgggtgctggtgaac
tgcgcgggcctgcacagcgaccggatcgcccggctggccggggacgacccgggcgtgcgg
atcgtgccgttccgcggcgagtactacgaactggtcgagcaacgccgcgccttggtgcgc
ggcctggtctacccggtgcccgacccggccttcccgttcctcggggtgcacctgacccgg
ggcatccacggggacgtccacgtcggcccgaacgcggtgcccgccctggcccgcgagggg
tatgcctggcacaccgtccgcccgcgcgatctggccgggaccctggccttccccggcacc
tggcggatcctccggcggcactggcgttacgaggtgggcgagctgcaccgctcgctgtcc
aagcgagcgttcaccacggccgtccaacggctgctgcccgccgtgaccgccgcggacctg
gtaccggcccccgccggggtgcgggcgcaggcggtggcccgggacggctcgctgctggac
gacttcgccttcgcgggcttcgacccggaggaccggcactccccgcgccgcgcggtgcac
gtgctgaacgccccctcccccgccgcgacggcctcgctgccgatcggccgcgaggtggcc
cgccgggccctggccgccctcgaggccggcggatga

DBGET integrated database retrieval system