KEGG   Kitasatospora aureofaciens: B6264_14370Help
Entry
B6264_14370       CDS       T05021                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
kau  Kitasatospora aureofaciens
Pathway
kau03010  Ribosome
Brite
KEGG Orthology (KO) [BR:kau00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    B6264_14370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:kau03011]
    B6264_14370
Ribosome [BR:kau03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    B6264_14370
  Bacteria
    B6264_14370
  Archaea
    B6264_14370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ARF79933
UniProt: A0A1E7NAG2
Position
3281218..3281565
Genome map
AA seq 115 aa AA seqDB search
MEARAQARYIRVTPMKARRVVDLIRGMNATEAQAVLRFAPQAATVPVGKVLDSAIANAAH
NYNHSNVDDLYISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVSSKEGTR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggaagccagggcacaggcgcggtacatccgcgtgacgcccatgaaggcccgccgcgtg
gtggacctcatccgtggcatgaatgccacggaggcccaggccgtcctgcgtttcgctccg
caggccgccaccgtgccggtcggcaaggtgctcgacagcgccattgccaacgccgcgcac
aactacaaccactccaacgtggacgacctctacatctccgaggcgtacgttgacgagggc
ccgaccctgaagcggttccgcccgcgtgcccagggccgtgcctaccggatccgcaagcgg
accagccacatcaccgtggtcgtcagcagcaaggaagggacccggtaa

DBGET integrated database retrieval system