KEGG   Kitasatospora aureofaciens: B6264_16955Help
Entry
B6264_16955       CDS       T05021                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
kau  Kitasatospora aureofaciens
Brite
KEGG Orthology (KO) [BR:kau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:kau03009]
    B6264_16955
Enzymes [BR:kau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     B6264_16955
Ribosome biogenesis [BR:kau03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    B6264_16955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_31 MTS Methyltransf_33
Motif
Other DBs
NCBI-ProteinID: ARF80371
UniProt: A0A1E7N000
Position
3861291..3862193
Genome map
AA seq 300 aa AA seqDB search
MLQDIEPYLACPHCAQALIRHERSLRCPAGHSFDLAKQGYVSLLAGDAHTGTGDTAEMVA
ARADFLTAGHYRPIADALAEAATALLGAAPSAGAAGPETTGSPEDPDGPDGLVVDLGAGT
GHYLAHVLDALPGRVGAALDISKFALRRAAKAHPRIGAVVCDAWRPLPLRDASAELMLNV
FAPRNGPEIRRVLRPGGTLLLVSPTANHLRELVDALGLLSVDEEKQRRIDEKLGPYLTPV
DQRSVEFTLRLSAQDVRTVVGMGPSAWHTDADRLAAALAALPEPVEVSASVTVAAYRRPR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttgctgcaggacattgagccctacctggcctgcccccactgcgcgcaggccctcatccgg
cacgagcgcagcctgcgctgccccgccgggcacagcttcgacctcgccaagcagggctac
gtcagcctcctcgccggtgacgcccacaccggcaccggcgacaccgccgagatggtcgcc
gcccgcgccgacttcctcaccgccgggcactaccggccgatcgccgacgccctcgccgaa
gccgccaccgctctgctcggagccgccccgtcggcgggcgctgccggaccggagaccacg
gggagcccggaggacccggacggcccggacggcctggtcgtcgacctcggcgccggtacc
ggccactacctggcgcacgtcctggacgccctgcccggccgggtcggcgccgccctcgac
atctccaagttcgcactgcgccgcgctgccaaggcccacccccggatcggcgccgtggtc
tgcgacgcctggcgcccgctgccgctgcgcgacgcctccgccgagctgatgctcaacgtc
ttcgccccgcgcaacggccccgagatccgccgcgtgctgcgccccggcggcaccctgctg
ctggtctcgcccaccgcgaaccacctgcgcgaactcgtcgacgccctcggcctgttgtcg
gtggacgaggagaagcagcgtcggatcgacgagaagctcggcccgtacctgacaccggtc
gaccagcggtcggtcgagttcaccctgcggctcagcgcccaggacgtccggaccgtcgtc
ggcatgggcccgagcgcctggcacaccgacgccgaccggctcgcggccgccctcgcggcc
ctgccggaaccggtagaggtgagcgcctcggtgacggtggccgcctaccggcgtccgcgg
tag

DBGET integrated database retrieval system