KEGG   Kitasatospora aureofaciens: B6264_18170Help
Entry
B6264_18170       CDS       T05021                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
kau  Kitasatospora aureofaciens
Pathway
kau00380  Tryptophan metabolism
kau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    B6264_18170
Enzymes [BR:kau01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     B6264_18170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: ARF80576
UniProt: A0A1E7MZ24
Position
complement(4127546..4128376)
Genome map
AA seq 276 aa AA seqDB search
MGHDTVETPNLSFGRGGQPGRGTPYAQYVRLEQLHSLQHPRSKEPAELSFIVTTQVMELL
FDLLRHEWTIAGQSLREDDLTAALAALRRGTHVQDVLVESWDLLATMTPQEFNSFRPLFG
EASGFQSSAFLHLEFLIGNKNAALLNMYDGMPEVRAELTEALRSPGLYDEVLGLLARRGL
AVHAEPSEQRYRPTEEVAAAWRRVYTEPEFAALQPLGEALLDVAERVTRWRQRHLSSVKR
TMGAKPGSGGSSGLTWLRKAAEQDVFPELWTIRDEL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggggcacgacacggtggagacacccaacctttcgttcggtcggggcggccagccgggt
cggggcaccccgtacgcgcagtacgtgcgcctggagcagttgcacagcctccagcacccg
cgcagcaaggagccggccgagctgtcgttcatcgtcaccacccaggtgatggagctgctc
ttcgacctgctgcggcacgagtggacgatcgccgggcagtcgttgcgcgaggacgacctg
accgccgcgctggccgcgctgcgccgcggcacccacgtgcaggacgtgctggtggagtcc
tgggacctgctggccaccatgacgccgcaggagttcaactccttccgcccgctgttcggc
gaggcctccggcttccagtcctcggccttcctgcacctggagttcctgatcggcaacaag
aacgccgcgctgctgaacatgtacgacgggatgccggaggtccgggccgagctgaccgag
gcgctgcgctcccccggcctgtacgacgaggtgctcggcctgctggcccggcgcggcctg
gccgtgcacgcggagccctccgagcagcgctaccggcccaccgaggaggtcgcggcggcc
tggcgccgggtgtacaccgagccggagttcgcggccctgcagccgctcggcgaggcactg
ctggacgtggccgagcgggtcacccgctggcgccagcgccatctgagctcggtcaagcgg
accatgggcgccaagcccggctcgggcggctccagcgggctgacctggctgcgcaaggcg
gccgagcaggacgtgttcccggagctgtggacgatccgggacgagctgtga

DBGET integrated database retrieval system