KEGG   Kitasatospora aureofaciens: B6264_18535Help
Entry
B6264_18535       CDS       T05021                                 

Definition
(GenBank) hypothetical protein
  KO
K14256  anhydrotetracycline 6-monooxygenase / 5a,11a-dehydrotetracycline 5-monooxygenase [EC:1.14.13.38 1.14.13.234]
Organism
kau  Kitasatospora aureofaciens
Pathway
kau00253  Tetracycline biosynthesis
kau01057  Biosynthesis of type II polyketide products
kau01100  Metabolic pathways
kau01110  Biosynthesis of secondary metabolites
kau01130  Biosynthesis of antibiotics
Module
kau_M00780  Tetracycline/oxytetracycline biosynthesis, pretetramide => tetracycline/oxytetracycline
kau_M00823  Chlortetracycline biosynthesis, pretetramide => chlortetracycline
Brite
KEGG Orthology (KO) [BR:kau00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    B6264_18535
   00253 Tetracycline biosynthesis
    B6264_18535
Enzymes [BR:kau01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.38  anhydrotetracycline 6-monooxygenase
     B6264_18535
    1.14.13.234  5a,11a-dehydrotetracycline 5-monooxygenase
     B6264_18535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 DAO DUF1059
Motif
Other DBs
NCBI-ProteinID: ARF82913
UniProt: A0A1V0W006
Position
complement(4207545..4208972)
Genome map
AA seq 475 aa AA seqDB search
MLACELALGGARAVVVERRREPEKHSKAMGMQGRTVELLELRGLLDRFKEGAGVLQGGNF
ASLGVPMRFEEFDTRHPYVLLVPQLRTEELLAERARELGVRIVRGSGVTGFAQDADGVTV
ETDTGLLRARYLVGCDGGGSTVRKAAGIGFTGQDPHMYALIGDMRFSGDLPRGEGLGPMR
PVGLVNPAKRSWFGAFQHQPGVYRATVAWFDRPFADRRAPVTEEEMRAALVEHTGSDHGM
HDVTWLSRLTDVSRLADSYRLGRVLLAGDAAHIHLPAGGQGLNLGFQDAVNLGWKLAAVV
RGHGTEELLDSYGRERRPIADGVVRNTRTQAVLIDPDPRYEALRQTFRDLMALPDTNRHI
AGMLSGFDVAYGGGDHPLVGRRMPDAELITADGPRRISDCFAGARGLLLLPEQGPTASPL
AAWADRVDTLTVKSGGPDPDTAHLVRPDGYVAWAGEPARTEELHHAATTWFGAAA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcctgcgaactggccctgggcggagcccgggcggtggtggtggaacggcgccgc
gagccggagaagcactccaaggccatgggcatgcagggccgcaccgtggaactgctcgaa
ctgcgcgggctgctcgaccgcttcaaggagggcgcgggcgtgctgcagggtggcaacttc
gccagcctgggcgtgccgatgcgcttcgaggagttcgacacccgccacccgtacgtgctg
ctggtgccccaactgcgcaccgaggagctgctcgccgaacgggcccgcgaactgggcgtg
cggatcgtgcgcggctcgggcgtcaccggcttcgcccaggacgccgacggggtcaccgtc
gagacggacacgggcctgcttcgggcacggtacctggtcggctgcgacggcggcggcagc
accgtccgcaaggccgccggcatcggcttcaccggacaggacccgcacatgtacgccctc
atcggcgacatgcgcttcagcggcgacctgccgcgcggcgagggcctcggcccaatgcgg
ccggtgggcctggtcaaccccgccaagcggtcctggttcggcgccttccagcaccagccg
ggcgtctaccgggccaccgtcgcctggttcgaccggcccttcgccgaccgccgcgccccg
gtcaccgaggaggagatgcgcgccgcactggtcgagcacaccggcagtgaccacgggatg
cacgacgtcacctggctgtcccgcctcaccgacgtctcccggctggccgactcctaccgg
ctgggccgggtgctgctggccggcgacgccgcgcacatccacctgccggccggcggccag
gggctcaacctgggcttccaggacgccgtcaacctcggctggaagctggccgccgtggtc
cgcggccacggcaccgaggagctgctggacagctacggccgcgagcgtcgcccgatcgcc
gacggcgtggtgcgcaacacccgcacccaggccgtcctgatcgacccggacccgcggtac
gaggcactgcgccagaccttccgcgacctgatggcgctgcccgacaccaaccgccacatc
gccggcatgctctccggcttcgacgtcgcctacggcggcggcgaccaccctctggtcggc
cgccggatgccggacgccgagctgatcaccgcggacgggccgcggaggatcagcgattgc
ttcgccggggcccgcggtctgctgctgctccccgaacagggcccgaccgcctcgccgctg
gccgcctgggcggaccgcgtggacaccctgaccgtcaagtcgggcggcccggacccggac
accgcccacctcgtccgcccggacggctacgtggcctgggccggcgaaccggcccgcacc
gaggaactgcaccacgccgcgaccacctggttcggcgcggcggcctga

DBGET integrated database retrieval system