KEGG   Kitasatospora aureofaciens: B6264_18540
Entry
B6264_18540       CDS       T05021                                 

Definition
(GenBank) PPOX class F420-dependent oxidoreductase
  KO
K21301  5a,11a-dehydrotetracycline reductase [EC:1.3.98.4]
Organism
kau  Kitasatospora aureofaciens
Pathway
kau00253  Tetracycline biosynthesis
kau01057  Biosynthesis of type II polyketide products
kau01100  Metabolic pathways
kau01110  Biosynthesis of secondary metabolites
Module
kau_M00780  Tetracycline/oxytetracycline biosynthesis, pretetramide => tetracycline/oxytetracycline
kau_M00823  Chlortetracycline biosynthesis, pretetramide => chlortetracycline
Brite
KEGG Orthology (KO) [BR:kau00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    B6264_18540
   00253 Tetracycline biosynthesis
    B6264_18540
Enzymes [BR:kau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.4  5a,11a-dehydrotetracycline reductase
     B6264_18540
SSDB
Motif
Pfam: Putative_PNPOx Pyridox_ox_2
Other DBs
NCBI-ProteinID: ARF80635
UniProt: S4S395
Position
4209182..4209604
AA seq 140 aa
MPFTAKEAAYLASQPLARLATVDGRGQPHVVPLGFHYNAELGTVDVTGRGMARSLKYRHV
QGHPRVSLVVDDIVDAQRWVVRGIEIRGTAVALATGGKEILPHVDDELIRITPERIVSWG
IDSDCQAPPLARNVGAGAQA
NT seq 423 nt   +upstreamnt  +downstreamnt
atgccattcaccgcgaaagaggccgcctacctggcctcgcagccgctcgcccgcctggcc
accgtggacggccggggacagccgcacgtcgtcccgctgggcttccactacaacgccgag
ctcggcaccgtcgacgtgaccgggcgcggcatggcccgcagcctcaagtaccgccacgtg
caggggcatccgcgggtgtcgctggtggtggacgacatcgtggacgcgcagcgctgggtc
gtccgcgggatcgagatccggggcaccgccgtcgcgctggcgaccggcggcaaggagatc
ctgccgcacgtcgacgacgagctgatccggatcacgccggagcggatcgtctcctggggc
atcgactccgactgccaggctccgccgctggcccgcaacgtcggggcgggggcgcaggca
tga

DBGET integrated database retrieval system