KEGG   Kitasatospora aureofaciens: B6264_19210Help
Entry
B6264_19210       CDS       T05021                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
kau  Kitasatospora aureofaciens
Pathway
kau00471  D-Glutamine and D-glutamate metabolism
kau00550  Peptidoglycan biosynthesis
kau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    B6264_19210
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B6264_19210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kau01011]
    B6264_19210
Enzymes [BR:kau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     B6264_19210
Peptidoglycan biosynthesis and degradation proteins [BR:kau01011]
 Precursor biosynthesis
  Amino acid ligase
   B6264_19210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C Pyr_redox CbiA
Motif
Other DBs
NCBI-ProteinID: ARF80752
UniProt: A0A1E7N4E4
Position
4364426..4365880
Genome map
AA seq 484 aa AA seqDB search
MTNPQMIESQLNDLPVVVAGLGVSGISAARVLNGLGARVTVVDGGGGEGLRARAAELEAL
GVAVRLGDGASLPEGTELVVTSPGWAPDSPLFAAAEAAGVPVWGDVELAWRLRKPLPGTG
EPAPWLAVTGTNGKTTTVQMLASILTAAGKRTAAVGNVGVSVLDAVLAEEPYDVLAVELS
SYQLHWAPSLRPYSAAVLNLAPDHLDWHGSMEAYAADKGRIYEGNVVACVYNLADPATEA
LVREADVEEGCRAIGFGLGAPGPSNFGVVDGLLVDRAFVEDRARNAAELGAVEDVNPPAP
HNIANALAAAALARAYGVEPKAVREGLRAFRPDAHRIAEVGTVREVTYIDDSKATNTHAA
AASLAAYRPIVWIAGGLAKGATFDDLVQGAAERLRAVVLIGQDRALIREALERHAPDVPV
IDAAEGQTGAVAMTAVVRTAASLARSGDTVLLAPACASMDMFTNYGERGDLFAAAVRELA
DSGE
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacccccagatgatcgagtcacagctcaatgacctgcccgtggtggtcgcgggc
ctcggcgtctcgggcatcagcgccgcgcgcgtcctgaacggcctcggcgcccgcgtcacc
gtggtggacggcggcggcggcgagggcctcagggcccgcgccgccgagctggaggcgctc
ggcgtcgcggtgcgcctgggcgacggcgcgagcctgcccgagggcaccgaactggtcgtc
acctcgcccggctgggcgcccgacagcccgctgttcgccgccgccgaggcggccggggtg
ccggtctggggcgacgtcgagctggcctggcggctgcgcaagccgctgccgggcaccggc
gagcccgccccctggctggccgtcaccggcaccaacggcaagaccaccaccgtccagatg
ctcgcctcgatcctcaccgcggccggcaagcgcaccgccgccgtcggcaacgtcggggtc
tcggtgctggacgcggtgctcgccgaggagccgtacgacgtgctcgccgtcgagctctcc
agctaccagctgcactgggcgccctcgctgcgcccgtactcggcggcggtgctcaacctg
gccccggaccacctcgactggcacggctcgatggaggcgtacgccgccgacaagggccgg
atctacgagggcaacgtggtggcctgcgtgtacaacctggccgacccggccaccgaggcg
ctggtccgggaggccgacgtcgaggagggctgccgggcgatcggtttcggcctcggcgcg
cccggcccgtcgaacttcggcgtggtggacggcctcctggtcgaccgcgccttcgtcgag
gaccgggccaggaacgcggccgagctgggcgccgtcgaggacgtcaacccgccggccccg
cacaacatcgccaacgcgctcgccgcggcggcgctggcccgggcgtacggggtcgagccg
aaggccgtccgggagggcctgcgggccttccgcccggacgcccaccggatcgccgaggtc
ggtacggtccgcgaggtcacgtacatcgacgactccaaggccaccaacacccacgccgcc
gcggcctcgctggcggcctaccggccgatcgtctggatcgccgggggactggccaagggc
gcgaccttcgacgacctggtccagggcgcggccgagcggctgcgggcggtcgtgctgatc
gggcaggaccgggcgctgatccgcgaggcgctggagcgacacgctccggatgtgccggtg
atcgatgcggccgagggccagactggcgcggtggcgatgaccgcggtcgttcgaacggcc
gcatcgctcgcccgatcgggtgacacggtgctgctggctccggcctgcgcgtcgatggac
atgttcaccaactacggcgagcgcggcgacctcttcgcggcggccgtccgggagctggcc
gactccggcgagtga

DBGET integrated database retrieval system