KEGG   Kozakia baliensis: A0U89_02955Help
Entry
A0U89_02955       CDS       T04547                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
kba  Kozakia baliensis
Brite
KEGG Orthology (KO) [BR:kba00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A0U89_02955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AOX16249
UniProt: A0A1D8URH4
Position
complement(659365..659838)
Genome map
AA seq 157 aa AA seqDB search
MPRKPVPPRLIADPESALAEAMEAAPRYECCTENITVCVRTFWLEDQSQPEDHRYAWAYH
IRIENGGDETIQLVSRSWEITDGGGQVEHVRGDGVVGEQPVIPTGESFEYTSGAALETPS
GFMRGTYQMIVPGKSRHFDVKIPAFSLDSPHHLGLVH
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtaaacccgttccccctcgccttatagccgaccccgaatctgcgcttgccgaa
gccatggaagccgcgccgcgctatgaatgctgcacggaaaatataactgtttgcgtgcgc
accttctggctagaagatcagtctcagccggaagatcatcgttacgcgtgggcctatcat
attcgcatcgagaatggcggtgatgagacgattcaactcgtcagccgttcttgggaaatt
acggatgggggcggccaagtcgaacatgtgcgcggcgatggcgttgtcggcgagcaaccg
gttattcctaccggtgagtcgttcgaatatacgtcaggggctgctttggagacgcccagc
ggcttcatgcgcggtacttatcaaatgatcgttcctggcaaatcgcggcatttcgatgtg
aaaattccagcgtttagcctggatagtccgcaccatttggggctagttcactaa

DBGET integrated database retrieval system