KEGG   Kozakia baliensis: A0U89_04535Help
Entry
A0U89_04535       CDS       T04547                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
kba  Kozakia baliensis
Pathway
kba00030  Pentose phosphate pathway
kba01100  Metabolic pathways
kba01120  Microbial metabolism in diverse environments
kba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A0U89_04535
Enzymes [BR:kba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     A0U89_04535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N ADD_ATRX Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AOX16509
UniProt: A0A1D8US86
Position
complement(992983..993783)
Genome map
AA seq 266 aa AA seqDB search
MATLDKNRFSGKKVLITGASQGIGEDAAIYFAEQGARVALNGRKEDKLRAVAEKLPKISG
GEHLIVAGDMSVEQDVDRVMRDTIQKMDGLDVLICNAGFQISCPSEDISLKDFQAVMAVN
VTGVVLCARAALKYWREKNLKGNIIVNSSVHQQIPKPHYLGYSASKGAVGNIVRTLALEY
ARHGIRVNAVAPGAIVTPINDSWVKDPKQYKAVSSHIPMQRPGESREISTVMGFLASDEA
SYITGQTIFADGGLTLYADFENNWSS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgctcgataagaaccgtttttccggcaagaaagttctcataaccggggcttcg
caaggaatcggagaagacgccgccatttacttcgccgagcaaggcgcgcgcgttgcgctc
aacggccgcaaggaagataagctacgcgccgtagccgagaaactaccgaaaatatccggc
ggcgaacacctcatcgtcgcaggcgacatgtccgtcgagcaagacgtagaccgcgtcatg
cgcgacacgatccagaagatggatgggttggacgttctgatctgcaatgcgggctttcag
atcagttgcccctcggaggatatctccctcaaggattttcaggccgtcatggccgtcaat
gtcacgggcgtcgttctctgcgctcgcgcggccttgaaatactggcgggagaaaaatctg
aaggggaacatcatcgtcaatagttccgtccatcagcagataccaaaaccccattatctc
ggctattcggccagcaaaggcgcggtcggcaacatagtgcgcactctcgcgcttgaatat
gcgcgtcacggtatccgcgtgaacgccgtcgcccccggcgcaatcgtgacgccgatcaac
gattcgtgggtgaaagaccccaagcaatataaagccgtctctagccatatccccatgcag
cgccctggcgagagccgcgagatttccaccgttatgggctttctcgcttcggacgaagct
tcctacatcaccgggcagacgatcttcgccgatggcggcctgacgctctatgccgatttc
gagaataactggtcctcgtaa

DBGET integrated database retrieval system