KEGG   Kozakia baliensis: A0U89_06115Help
Entry
A0U89_06115       CDS       T04547                                 

Definition
(GenBank) precorrin-6Y methyltransferase
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
kba  Kozakia baliensis
Pathway
kba00860  Porphyrin and chlorophyll metabolism
kba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kba00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A0U89_06115
Enzymes [BR:kba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     A0U89_06115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: AOX16776
UniProt: A0A1D8UT34
Position
complement(1334484..1335668)
Genome map
AA seq 394 aa AA seqDB search
MAEPWLAIIGIGEDGMAGLSAACHAELASAEVIFGGPRHLALVNAGDRGRAWPVPFSVEP
VFAERSRRRVVALASGDPFWFGAGAILAAQLEPGEWRSYPSVSTFSLMANRLGWRLEQSC
CFGLHAAPFERLLPVLHTGAHILCLLRDGPAVAALAQWLVARKFGFATLHVMEALGGPRE
RVRAIRANECALKDIAAPVAVAIAVAGGHGLSRASGLLDESFVHDGQITKRPIRALTISA
LAPRPGELLWDLGAGSGSISVEWCLTGGRAIAVEARLDRVVNIHTNTHAFGLDHRLRIVE
GEAPVALTELPDPDAVFIGGGASAELLDYLWSRLPIGTRIVANGVTLETETLLAIWQEQK
GGELLRIELAHAAPLGSMRGWRPARPVMQWSVIR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaccctggcttgcgatcatcggtatcggtgaggatggcatggcaggtttatcg
gcggcgtgccatgccgaactggcctccgctgaggtgattttcggcggtcctcgtcatctt
gcgctcgtaaatgcgggagatagaggccgggcgtggccggtcccattctcggtcgaaccc
gtttttgccgaacgtagtcgccgccgggtggtggcgttggcttcgggcgatccgttttgg
ttcggcgctggcgccatcctcgccgcgcagcttgagccgggcgaatggcgatcctatcca
tcggtttcgacgttttccctgatggccaaccgattgggttggcggctcgaacaatcatgc
tgcttcggattgcacgccgcgcctttcgaacggcttctgcccgtgctccacaccggggcg
catattctttgcctgttgcgtgacgggccagcagtcgcagcactggcacaatggctggtt
gcgcgaaaattcggttttgccacccttcacgtcatggaagcgcttggcggtccgcgtgag
cgtgtccgcgccatccgcgcgaatgaatgcgccttgaaggatatcgcagcaccagtcgcc
gtggctatcgccgtagcgggcgggcatgggctgagtcgggcttccggtttgctcgatgaa
agcttcgtgcatgacgggcagatcaccaagcgaccgatccgcgcgctcaccatttcggct
ttggccccacgtcctggcgaacttctatgggaccttggggcgggctccgggtcgatctcg
gtggaatggtgcctgacgggagggcgtgcgatcgccgtcgaagcgcgtcttgatcgtgtc
gtaaatatccacacgaacacgcatgctttcggtctcgatcatcgccttcggatcgtggaa
ggtgaagctcccgtcgcgttgacggagttgcccgatccggatgccgtgttcatcggcggt
ggggctagcgcggaactgttggattatttgtggagccgattgcctattgggacgcgaatc
gtcgccaatggcgtcacgctggaaactgagacgctccttgcgatatggcaggagcaaaaa
ggcggcgaattgcttcggatcgaattggctcacgccgctccattgggatcgatgcggggg
tggcgtcccgcgcgaccggtcatgcaatggagcgtaatacgatga

DBGET integrated database retrieval system