KEGG   Kozakia baliensis: A0U89_08205Help
Entry
A0U89_08205       CDS       T04547                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
kba  Kozakia baliensis
Pathway
kba00030  Pentose phosphate pathway
kba00480  Glutathione metabolism
kba01100  Metabolic pathways
kba01110  Biosynthesis of secondary metabolites
kba01120  Microbial metabolism in diverse environments
kba01130  Biosynthesis of antibiotics
kba01200  Carbon metabolism
Module
kba_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:kba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A0U89_08205
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A0U89_08205
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kba04147]
    A0U89_08205
Enzymes [BR:kba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     A0U89_08205
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     A0U89_08205
Exosome [BR:kba04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   A0U89_08205
  Exosomal proteins of colorectal cancer cells
   A0U89_08205
  Exosomal proteins of bladder cancer cells
   A0U89_08205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AOX17130
UniProt: A0A1D8UU13
Position
1757971..1759440
Genome map
AA seq 489 aa AA seqDB search
MTQAQQVKPFDYIIFGATGDLTMRKLLPAFYYRLSAGQVPHNARIIGTARSPLERSVYQD
RARDALKRFVQPHDFHEDLVEQFLNMIHYVSLDGSKAESNWENLRSLLNESPQEQIRVFY
FATAPNLYGAISENLHKEGLVTEESRVVLEKPIGIDLASADQINNEVGRFFKENNVFRID
HYLGKETVQDVIALRFANPALEAVWSAKYIQSVQITAAETVGVEGRAAYYDHSGALRDMV
QNHLLQVLCLVAMEQPASLEADAVRDAKVKVLQSLRPMDETRLKNDTVRGQYTAGQSNGI
AVPGYLQELGESSNTETYVALRAEIDNPRWNGVPFYIRTAKRLKQKVSEIVIRFKAPETS
LFPQQPRSSLLVIRIQPDEGLSWSLETKNPLDDNFALQKATLDVNFSKAFDVRYPDAYER
LLLDAVRGYPVLFIRRDEVEAAWRWVAPIMEAWANNEVPMTEYKAGSWGPKQAEEMLAAR
GDVWHEDME
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagctcagcaagtaaagccgttcgattatatcatcttcggtgccacgggcgat
ttgaccatgcgcaaattgctaccagccttttactaccggcttagcgcgggacaggtgccg
cacaacgctcgcatcatcggaacggcacgctcacctttggaacgcagcgtttatcaggat
cgcgcgcgcgatgctctgaaacgtttcgtccagccccacgatttccacgaagatctggtc
gagcagtttctgaacatgatccattacgttagcctcgacggttcgaaggctgaaagtaat
tgggaaaatctgcgcagcctgctgaacgaaagcccgcaagagcaaatccgggtcttctat
ttcgccacggcgcccaatctctacggtgcaatctccgaaaacctccataaagaaggtttg
gtgaccgaagaaagccgtgtcgtgctcgagaagccgatcgggatcgatctcgccagcgcg
gatcagatcaacaatgaagtcggccgtttctttaaggaaaacaacgttttccgtatcgac
cattatctcggcaaagaaaccgtgcaggatgtgattgccctgcgtttcgccaaccctgcc
ctggaggccgtctggtcggccaaatatatccaatccgtccagatcacggcggctgaaacc
gtcggcgtcgaaggccgcgcagcctattacgatcattccggtgcgctgcgcgatatggtg
caaaaccaccttctacaggtgctctgtctcgtcgctatggagcaacccgcttcattggaa
gccgatgccgtacgcgacgccaaggtgaaggtgctgcaatctcttcgcccgatggatgaa
acgcgcctgaagaacgatacggttcgtgggcaatatactgcgggacaatccaatggcatc
gccgtccctggctatcttcaagagcttggagaatccagcaatacggaaacatacgtcgcg
cttcgtgccgaaatcgataatccgcgctggaacggcgtgccgttctatatccgcacggca
aagcgtctgaaacaaaaggttagcgagatcgtcatccgcttcaaagcgcccgaaacatct
ctctttccgcagcaaccgcgctcaagcctgctcgtcatccgcattcagcccgacgaaggc
ttgtcgtggagcctggaaaccaagaacccacttgacgataacttcgcgcttcagaaagcg
acgctcgacgtcaatttcagcaaagcgttcgacgttcgctatccggatgcttatgagcgc
ttgctcttagacgcagttcggggttatccggttctcttcatccgccgcgatgaggtcgag
gccgcttggcgctgggtcgctccgatcatggaagcctgggcgaacaacgaagtgccgatg
acggaatacaaggctggcagctggggcccgaaacaggccgaggagatgcttgccgcgcgt
ggcgatgtttggcacgaagacatggaataa

DBGET integrated database retrieval system