KEGG   Kozakia baliensis: A0U89_11185Help
Entry
A0U89_11185       CDS       T04547                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kba  Kozakia baliensis
Pathway
kba00260  Glycine, serine and threonine metabolism
kba01100  Metabolic pathways
kba01110  Biosynthesis of secondary metabolites
kba01120  Microbial metabolism in diverse environments
kba01130  Biosynthesis of antibiotics
kba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A0U89_11185
Enzymes [BR:kba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     A0U89_11185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AOX17617
UniProt: A0A1D8UVU9
Position
complement(2389710..2390735)
Genome map
AA seq 341 aa AA seqDB search
MAQQFASDNYAGICPEVWAAMQDANQGSVPAYGEDPWTTRAAEAFRRLFETDCEVFFAFN
GTAANSLALAALCQSYNSVICSSFAHVETDECGAPEFFSNGSKLLVARTDNAKLTPADIR
ALATCRADIHYPKPRAVTITQPTETGEVYSLDEIREISAICRQLGLRLHMDGARFANACA
ALGCTPAEMTWQAGVDVLCFGGTKNGMAVGEAILFFDRTLAEGFDYRCKQAGQLASKMRF
LAAPWIGLLETGAWLRNGAHANACAARLAAEVAGLPDIELMFPAEANAVFLRAPEPVLIA
LRDRGWRFYTFIGGGARFMFAWDADPARVDALAADIAACTA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtggcccagcaattcgcaagcgacaattacgccggtatctgccctgaggtttgggcggct
atgcaagacgccaaccaaggctcggtcccggcctatggcgaagacccctggaccacccgc
gccgccgaagcctttcgccgcctgttcgaaacggattgcgaagtctttttcgccttcaac
ggcacagcggctaactccctggccctagctgcgctctgccaatcctataacagcgtgatc
tgctcctccttcgcgcatgtcgaaaccgatgaatgcggcgcaccggaattcttctccaac
ggctccaaactcctggtcgcccgcactgataacgccaagctgacgcccgccgatatccgt
gccctggccacctgccgcgccgatatccactaccctaagccccgcgcggtgacgattacc
cagcccaccgagaccggcgaagtctattcgctcgacgaaatccgcgagatctcggctatt
tgccgccaacttggcctgcgactgcatatggatggcgcgcgcttcgccaatgcctgcgcc
gccctgggctgcacgcctgcggaaatgacatggcaagcgggtgtggacgtgctctgcttc
ggtggcaccaaaaacggcatggcggtgggtgaggcgatcctgttcttcgaccgcaccttg
gcggaaggcttcgattaccgctgcaaacaagccggacaactcgcctccaaaatgcgcttt
ctcgccgccccttggatcggcctgctggaaaccggcgcgtggctgcgcaacggcgcgcac
gccaatgcttgcgccgcgcggctggccgcggaagtagcgggcctgcccgatatcgaattg
atgttcccggcagaagccaacgccgtgttcctgcgcgcgcccgaacccgtcctgatcgcc
ctgcgggaccgcggctggcgcttctataccttcattggcggtggtgcgcgctttatgttc
gcgtgggacgccgacccggcgcgcgtggacgccctggcggcggatattgccgcctgcact
gcatga

DBGET integrated database retrieval system