KEGG   Kozakia baliensis: A0U89_15775Help
Entry
A0U89_15775       CDS       T04547                                 

Definition
(GenBank) phospholipase
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
kba  Kozakia baliensis
Pathway
kba00562  Inositol phosphate metabolism
kba00564  Glycerophospholipid metabolism
kba01100  Metabolic pathways
kba01110  Biosynthesis of secondary metabolites
kba02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:kba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    A0U89_15775
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A0U89_15775
   00565 Ether lipid metabolism
    A0U89_15775
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A0U89_15775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:kba02042]
    A0U89_15775
Enzymes [BR:kba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     A0U89_15775
Bacterial toxins [BR:kba02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   A0U89_15775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AOX18762
UniProt: A0A1D8UYX6
Position
pKB14400_3:54978..56642
Genome map
AA seq 554 aa AA seqDB search
MPPLSQRFLLACTLPLLGILPLFHVTTARAAEAQPTTPIHHLIIIYDENVSFDHYFATYP
HAANPNGEPTFIPARNTPTVNTLEAAHLLAENPNAYPANGADAALPFRLDISQASTADQN
HAYTPEQLAYHHGKADLFPRYTGRGTPGGVGAFSTRGQVMGYFDGNTVAALWRYAQRFAM
SDAAYTDTYGPSTPGALEVSSGQTNGMRIKTTTQPPASAKIHSPYADDGAGGWTMINDID
PADDVCSTPKNQVWMSNRNVGDLLNAQNVSWGGFMGGFDLTRQNSNGTTGCGRSTYSTIV
TQTVPDYIPHHNWFQYHTTTANPSHARPSSIAAIGHSTMTDGKTRDPANHQYDLEDFFAV
SRAGTMPAVSFIKLPAYQDGHAGYSNPLDEQQGIVRVVNFVQSRPEWKDTAIIIAYDDSD
GWYDHAFTPVAHASYDPEIDQLDGPGRCGKGSRPFGVAGRPVNGRCGPGTRIPFLVLSPW
VRPNSINHTLITQSSITRFIEDNWLHGTRLGDGAFDADAPPMNGLFDFSHTPLLDPLYLE
PKNGIVISEPTDQN
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctctttcccaacgtttcctcctcgcctgcacacttcccctactcggcattctc
cccctatttcacgtaacaacggcccgtgcggcagaggcccaacctacgacaccgattcat
catctcattatcatctatgatgaaaatgtttcgttcgatcattatttcgccacctatccg
cacgcagcaaacccgaatggcgaaccgacttttatcccagccagaaatactccaactgtc
aacacgctagaagcagcccatctcctggccgaaaacccgaatgcatatcctgccaacggc
gcagacgcagcacttccttttcgtttggatatcagtcaggccagcactgccgaccaaaac
cacgcatacacacctgaacagcttgcctaccatcacggcaaggcagatctattcccccgc
tacaccggtcgcggcacgcctgggggcgttggcgccttttcaacccgtggacaggtcatg
ggttatttcgatggcaacaccgttgccgcactctggcgttacgctcagcgcttcgccatg
agcgatgcggcctacaccgacacatatggcccttccactccgggtgcgctcgaagtctcc
tctgggcagaccaacggtatgcgtatcaaaaccaccacgcagcctcctgcttccgccaag
atccattctccttatgctgatgacggcgcaggtggttggaccatgatcaacgacatcgat
cctgctgacgatgtctgttccacacccaaaaatcaggtgtggatgagcaatcgcaacgtt
ggtgatctgctcaacgcacaaaatgtctcatggggcggctttatgggcggtttcgatctt
actcgacaaaactccaatggcactaccggctgcggccgctccacctattcgacgatcgtt
acgcaaacagttccagactatattccgcaccataattggttccaatatcacaccacgacc
gccaacccgtcccacgcgcgaccctcctcaatcgccgccattggccatagcacgatgact
gatggaaaaacgcgcgatcctgccaaccatcagtacgatcttgaggatttctttgctgta
tcgcgcgccggaacaatgcctgccgtttctttcatcaagcttccggcttatcaggatggc
cacgctggctactccaatcctctcgacgaacaacagggcatcgttcgcgtcgtgaacttt
gtccagagccgtcccgagtggaaagatactgccatcattatcgcttatgatgattccgat
ggttggtatgatcacgcttttacaccggtagcccacgcatcttatgatcccgagatcgat
cagcttgacggccctggacgctgtggaaaaggctcacggccttttggtgtagctggcaga
cccgtcaatggtcgctgcggccccggaacgcgcataccgtttctcgttctttcaccttgg
gtgcgccccaattccattaaccatacgctaattacccaaagttccatcacacgcttcatt
gaggataactggcttcatggcacacggctcggcgacggtgcgttcgatgccgacgccccc
cctatgaatggcttgttcgatttcagccacacgccactcctcgacccactctatctggag
ccgaaaaatggtatcgtcatttctgaaccgactgaccagaactaa

DBGET integrated database retrieval system