KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00204Help
Entry
CKBE_00204        CDS       T02427                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
kbl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kbl01100  Metabolic pathways
kbl01110  Biosynthesis of secondary metabolites
kbl01130  Biosynthesis of antibiotics
kbl01230  Biosynthesis of amino acids
Module
kbl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kbl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKBE_00204 (trpC)
Enzymes [BR:kbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CKBE_00204 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFZ83393
Position
complement(211636..212424)
Genome map
AA seq 262 aa AA seqDB search
MNDILKKIVLAKKEEIIIAKQKNSNSALVEKICEQDPTRGFADAIEKKVQQGLPSVIAEI
KKASPSKGILRKDFDPEKFAITYAKNGATCLSVLTDREFFHGCCEDLLRARSSCNLPILR
KDFVIDPYQVLEARSIGADCILLIVSILDINQLIDLEAIAMELGMDVLVETHTRHEIDAA
LHLKTKLIGINNRNLGSFHTDINNTLNLKEYVPNEKIIITESGFSSKEDIEIMRKSNINA
FLIGEVFMKSTDPGQKLSELIS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatattttaaagaaaattgtactcgcaaaaaaagaagaaataataatagcaaaa
caaaaaaacagcaattccgctcttgttgaaaaaatatgcgaacaagatcctaccaggggt
tttgctgatgcaatagaaaaaaaggttcaacaaggattgccaagcgttatagcagaaata
aaaaaagcatctccatctaaaggaatattaagaaaagattttgatccagaaaaatttgcc
attacctatgccaaaaatggggcaacttgcttatcagtattaactgatagagaatttttc
catggatgttgtgaggacctacttagagctagatcatcctgtaatttaccaattctgcgt
aaagattttgtaatagatccttatcaagttttagaagcacgatcaataggagcagattgt
atattattaatagtatctatacttgatatcaatcaattaatagatctagaagcaattgca
atggaattgggaatggatgtcttggtagaaacgcatacccgacatgaaattgacgcggca
ttacatctaaaaacaaaacttattggaattaataatagaaatctcggtagtttccataca
gacataaataacacattaaatctaaaggaatatgtgccaaacgaaaaaataataattact
gagagtggattctcttcaaaagaagatatagaaataatgagaaaatcaaatataaatgca
ttcttaataggggaagtatttatgaagtctacagacccaggacaaaaattaagcgaacta
atatcttga

DBGET integrated database retrieval system