KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00474Help
Entry
CKBE_00474        CDS       T02427                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
kbl00220  Arginine biosynthesis
kbl01100  Metabolic pathways
kbl01110  Biosynthesis of secondary metabolites
kbl01130  Biosynthesis of antibiotics
kbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CKBE_00474 (argF)
Enzymes [BR:kbl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     CKBE_00474 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AFZ83663
Position
520339..521142
Genome map
AA seq 267 aa AA seqDB search
MPLHDRTLAMIFEKASTRTRVSFEAGMYQMGGSVINLTNNDSQLGRSEPIEDTAKVVSRM
VDIVMIRTFDQTRIEKFAAHSRVPVINGLTNEFHPCQILADIFTFLEHRDSIVGKKIAWI
GDANNMSYTWVQAAEILGFTLHFSSPNDYKMDSSIVGNVSSSYLKQFDDPREACKDVDLV
TTDVWTSMGYESENTKRLEAFADWAVDDNMMSMANSDALFMHCLPAHRGEEVTASVIDGP
QSVVWDEAENRMHLQKALMEFLILGKL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgccattacatgatcgaacactagctatgatttttgaaaaggctagtactagaactagg
gtttctttcgaggctgggatgtaccaaatgggaggatcagtaattaatctcacaaataat
gattcacagcttggcagatcagagccgatcgaagatacggctaaagttgtatctagaatg
gttgatatcgtaatgattagaactttcgatcagactagaattgagaaatttgctgctcat
tcgcgtgttccagttattaatggtttgactaatgaatttcatccatgtcaaattttagca
gatatatttacttttttagagcatagagattctatagttggaaaaaaaatagcatggatt
ggtgatgcaaataatatgtcatatacatgggtgcaagcagctgaaattcttggttttact
ctacatttttcttctccaaatgattataaaatggatagttctatagtaggtaatgtatca
agttcttacttaaagcagtttgatgatcccagagaagcatgtaaagatgtagatcttgtc
acaacagatgtttggacaagcatgggatatgaatctgagaatacaaaaaggctagaagca
tttgctgattgggcagtagatgataatatgatgtctatggctaatagtgacgctttattc
atgcattgtttgcctgcacatagaggtgaggaagtcaccgcaagtgttatagatggtcct
cagagtgttgtttgggatgaggcagaaaacaggatgcatttacagaaagcattaatggaa
tttcttatattaggaaaactttag

DBGET integrated database retrieval system