KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00567Help
Entry
CKBE_00567        CDS       T02427                                 

Definition
(GenBank) hypothetical protein
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
kbl00230  Purine metabolism
kbl00240  Pyrimidine metabolism
kbl01100  Metabolic pathways
kbl03030  DNA replication
kbl03430  Mismatch repair
kbl03440  Homologous recombination
Module
kbl_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:kbl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CKBE_00567
   00240 Pyrimidine metabolism
    CKBE_00567
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CKBE_00567
   03430 Mismatch repair
    CKBE_00567
   03440 Homologous recombination
    CKBE_00567
Enzymes [BR:kbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CKBE_00567
DNA replication proteins [BR:kbl03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CKBE_00567
DNA repair and recombination proteins [BR:kbl03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     CKBE_00567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AFZ83756
Position
635412..635858
Genome map
AA seq 148 aa AA seqDB search
MEINFIFGIKKRMDAVCQIINGYYLNKRRVVVYSNEYDILCKLNIMLWTFKDVSFIPHSF
YQKKNNCEEEYIIISDYLSQTSHIKNNEMLLVNMSNILPLCYNDFDCVVEIVTEDEQERS
EARSRWRTYKNDGHILTSCHFNDLVFSK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaattttatttttggaataaaaaaaaggatggatgctgtctgtcaaataata
aatggatactatctaaataaaaggagagtagttgtatattctaacgaatatgatatttta
tgcaaactaaatataatgttatggactttcaaagacgtatcttttataccacactcattc
tatcaaaaaaaaaacaattgcgaagaggaatatataattatttctgattatctatcacaa
acaagccacataaaaaacaatgagatgttgttggttaacatgtctaatatcttacccttg
tgttataatgactttgattgtgtcgtagagatagtaacagaagatgaacaagagcgcagt
gaggctaggtctagatggaggacttataaaaatgatggtcatatattgacaagttgtcat
tttaatgatttagtcttttctaaatag

DBGET integrated database retrieval system