KEGG   Ktedonobacterales bacterium SCAWS-G2: EPA93_15155Help
Entry
EPA93_15155       CDS       T05969                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kbs  Ktedonobacterales bacterium SCAWS-G2
Pathway
kbs00260  Glycine, serine and threonine metabolism
kbs01100  Metabolic pathways
kbs01110  Biosynthesis of secondary metabolites
kbs01120  Microbial metabolism in diverse environments
kbs01130  Biosynthesis of antibiotics
kbs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kbs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EPA93_15155
Enzymes [BR:kbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     EPA93_15155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3
Motif
Other DBs
NCBI-ProteinID: QBD77258
UniProt: A0A4P6JPF1
Position
3389117..3390166
Genome map
AA seq 349 aa AA seqDB search
MIELRSDTFTLPTDSMRAAITQAVLGDDVYGEDPTVRRLEELAASICGKENSCLMPSGTM
ANLVALLVHCPRGFKALVGNESDIYIYEAGGASVCGSIMYEPIPTQPDGSLLISDLAAAM
PEERDDPQYALPALLCLENTHNRCGGVVLDPTYLRRAAAFAHEQQMNIHLDGARIFHAAT
ALRVGVAELVHEMDSLQFCLSKGLAAPIGSMLVGSRSFIEQARRMRKMLGGGMRQAGIIA
AAGLVALEQMTDRLEEDHRHARLFAERLAEWPEIAITLKNVQTNIVLFKVIHERFTSKTV
IEAAHQRGLNLSELGHGNIRAVFHYGITEKNVEQALEIISGLLHTTNQG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaactgcgtagcgacacattcactctgcccacagacagcatgcgagctgccatt
acccaggccgtcctcggtgatgatgtctatggggaagatcccactgtgcgtcggttagaa
gagctggccgcgtccatctgtgggaaagagaatagttgcctgatgcccagcggcaccatg
gccaacctggtcgccctgctagttcattgccccagaggtttcaaagcactggtcggcaac
gaatcagacatctacatctatgaagcaggtggagcttcggtgtgcggaagcatcatgtac
gaaccgattcccacacagccagacgggagcctgctaatcagcgatctggccgcagcaatg
ccggaggaacgagacgatccacagtacgccttgccagcattgctctgcctggaaaacacc
cataatcgctgtggtggcgttgttctcgaccctacctacctgcgccgggccgcggccttt
gcccacgagcagcagatgaacattcacctggacggagcccgaatctttcacgccgctacc
gccctgcgcgtcggtgtagctgagttggttcacgagatggactcgctccagttctgcctc
tcaaaagggcttgctgcacccattggctccatgctggtaggtagccggagctttattgag
caggcccgccgcatgcgcaaaatgcttgggggaggcatgaggcaggctggcattattgcg
gcggcaggccttgttgccctggaacagatgacagatcgtctggaggaagatcatcgccat
gctcgcctgtttgctgaacggctggccgagtggccagagatagccataacgctcaagaat
gtccagacgaatatcgtcctgttcaaggtcattcatgagcgctttacctctaaaacagtc
atcgaggctgcgcatcagcgtggcttgaacttgagcgaactggggcatggcaacatacga
gccgtattccactatggtattacagagaaaaatgtcgagcaagcacttgagattatctca
gggctactccacactaccaaccagggctga

DBGET integrated database retrieval system