KEGG   Ktedonobacterales bacterium SCAWS-G2: EPA93_16200Help
Entry
EPA93_16200       CDS       T05969                                 

Definition
(GenBank) class I SAM-dependent methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
kbs  Ktedonobacterales bacterium SCAWS-G2
Brite
KEGG Orthology (KO) [BR:kbs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EPA93_16200
Enzymes [BR:kbs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     EPA93_16200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_12 CheR MTS PCMT
Motif
Other DBs
NCBI-ProteinID: QBD77449
UniProt: A0A4P6JPX9
Position
complement(3636740..3637456)
Genome map
AA seq 238 aa AA seqDB search
MSFLFKDTERAARRLQIVADVFAFSSRPFLQAVVGTAPEVAIDLGCGPGYTTCLLAEVSQ
CVRAIGLGSSEYFLWQAQRNAPTYFSFVRHDVTHIPFPTEPCDLIFCRLLLTHLQVQISV
LERWGTQLRPQDLLLVEEVEWVRTEHPLLRRYLEIQTALFKQRGNELYIGLGLEQYRVND
GLRRCLSRVSGTCFYDTGSYHVFPESPIVETPSFRSAAVWGRHRAPGTRFASPGDPCH
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttctttttaaagatacagagagggcggcacgtagattgcaaatcgttgctgac
gtgtttgccttctcaagccgtccgttcctgcaagcagtggttggcacagcaccagaggtt
gctatcgatctgggatgtgggccgggatataccacgtgccttctggcggaggtctcacag
tgtgttcgagccatcggccttggtagttccgaatactttctctggcaggctcagagaaac
gcaccaacgtatttctcgtttgttcgtcatgatgtgacacatatcccctttccaactgaa
ccatgcgatctcatcttctgccgtctgctgttgacccacctccaagtgcagatctctgtg
cttgagcgctgggggacgcaactgcggccacaggatttactactggtggaagaagtcgaa
tgggttcggacggaacacccgctcttgcgccgctacctggagattcagacggctctgttc
aaacagcgaggcaacgaactctatatcggccttgggcttgagcaataccgggtgaatgat
gggctcagacgctgcctgagtcgtgtctcaggtacctgtttctacgacacaggtagctac
catgttttccctgaatctcccattgtggaaacaccatcctttcgttcagcagcagtatgg
ggccgtcatcgagcacctggaacgaggtttgcaagccctggcgatccgtgccactag

DBGET integrated database retrieval system