KEGG   Ktedonobacterales bacterium SCAWS-G2: EPA93_18350Help
Entry
EPA93_18350       CDS       T05969                                 

Gene name
tenA
Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
kbs  Ktedonobacterales bacterium SCAWS-G2
Pathway
kbs00730  Thiamine metabolism
kbs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kbs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    EPA93_18350 (tenA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:kbs03000]
    EPA93_18350 (tenA)
Enzymes [BR:kbs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     EPA93_18350 (tenA)
Transcription factors [BR:kbs03000]
 Prokaryotic Type
  Other transcription factors
   Others
    EPA93_18350 (tenA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: QBD77846
UniProt: A0A4P6JSK2
Position
complement(4154879..4155598)
Genome map
AA seq 239 aa AA seqDB search
MSHTENSSAAIRSGTDSPSLSERLRQSVLGLWQRQLLHPFVVALGDGSLPQANFEFYIRQ
DARFLDVLIQVFAYAITKTTEHSDMEQLGKYVLQTLLVEADLHRRYGERFGLSASEMANT
PLAPSNYAYTRHLLSIATTGTLPEVLTSTLPCAWLYADVGRHLVGDSTLTADHPYADWLA
TYASPDFDAVEIWIRGWLDEHAATIDAQQERRLQEIFTISTRYEWMFWDMAWKLEVWPS
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatactgagaactcgtctgccgctatacggtccgggactgatagtcccagtttg
agcgaacgtttgcggcaaagcgttctgggtctctggcagaggcagttgctgcaccctttc
gtggtagctttaggcgatggctcgttaccacaggctaattttgaattctacattcgtcaa
gatgcacgcttccttgacgtgctgatccaggtttttgcctacgcgatcacgaaaactacc
gagcatagcgatatggagcaactgggaaagtatgtcttgcagacgttgcttgtcgaagct
gatctgcatcgccgttatggtgagcgcttcggccttagcgccagtgagatggccaacaca
ccgctggcgccttcgaactatgcctatacgcgccatctgctctcgatcgccacaacggga
accctacctgaagtgcttacttcaacgctgccctgtgcctggctttacgctgatgtgggg
cgtcacctggtgggcgatagcaccctgactgccgatcatccctatgccgactggctagca
acttatgcctcgcccgattttgatgccgtagagatctggattcgtggctggctggatgag
catgcggctaccatcgatgctcagcaggagaggcgcttgcaagaaatctttacaatcagt
acgcgttatgaatggatgttctgggatatggcctggaaattggaggtttggccgtcatga

DBGET integrated database retrieval system