KEGG   Ktedonobacterales bacterium SCAWS-G2: EPA93_20595Help
Entry
EPA93_20595       CDS       T05969                                 

Definition
(GenBank) ATP-dependent RecD-like DNA helicase
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
kbs  Ktedonobacterales bacterium SCAWS-G2
Pathway
kbs03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:kbs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EPA93_20595
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kbs03400]
    EPA93_20595
Enzymes [BR:kbs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EPA93_20595
DNA repair and recombination proteins [BR:kbs03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EPA93_20595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 SH3_13 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 AAA_22 HHH_2 Helicase_RecD PIF1 MeaB AAA_28 T2SSE AAA_16 AAA_29 IstB_IS21 PhoH AAA_12 TrwB_AAD_bind DUF815 NACHT NTPase_1 UvrD_C AAA_7 AAA_18 ABC_tran DUF2075 AAA RsgA_GTPase SspH AAA_5 AAA_10
Motif
Other DBs
NCBI-ProteinID: QBD78266
UniProt: A0A4P6JTN1
Position
complement(4700043..4702325)
Genome map
AA seq 760 aa AA seqDB search
MPALEGSVENIVFRNEDNHYTVARFRPKDSGRLFRDDLTTLVGIMPGIRTGELLTVEGEW
ENDPRYGKQLRVTSFTQRLPASTEGIIRYLSSGLIKGIGPKKASLIVEHFGEQTLAIIEQ
QPERLREVKGIGAKDCNQIIKAWAEQSEIKELHLFLQSHDVSINVATRIYKQYGKESIKV
IRANPYQLAQEVHGIGFRTADEIAVKLGLPPDSLPRLASGLKYVLTQAANEEGHCFLREA
DLMQRASEALKASPEILPHALDILRSEQDIFVEPPEAAATATLDDEWAAEEDSAEPTNLQ
ARIYYGPFWYAESGSARLLRSLLNSPSSLPPAPQKLWDTVFVLLKQKRNMHLTEKQRAAV
QMAYNNKVCILTGGPGTGKSTSIRALLMLLRNRKVDVALAAPTGRAAKRLAEATGVQAQT
LHRLLEYAPHDNSYQRNEDRPLSHQFVIVDEFSMVDILLFYHLLKALPREAHLLLVGDAD
QLPSVGPGNVLHDLLAGEAIPTVRLTELFRQAQQSKIIVNAHRINAGAMPSTKIEANSDF
FFMAEEDPMRAQQLILDLVQRRLPARYHFNPLTDIQVLAPMYKGPIGVTMLNECLQERLN
PRAFAQVELGDHILRVGDKVMQTRNNYDKGVFNGDIGWIRSISRENATAKVEFVEETGST
FVSYDFNELDELTLAYAVTVHKSQGSEYPAIVLPLVLQHRMLLQRNLLYTAITRAKRFCV
LVGQPQALEIAVRNARIAQRNTALAERLLAWSKGSAQTLV
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgccagcgcttgaaggttctgttgaaaacatcgtctttcgtaatgaagataatcactat
actgtagcgcgttttcgccccaaagatagtgggcggctctttcgcgatgatctaacgact
ctcgtcggcattatgccgggtattcgtaccggggaactgctcacagtagaaggcgaatgg
gaaaacgatccgcgctacggcaagcaattgcgcgtaaccagctttactcagcgcctacca
gcttctaccgaaggtatcattcgctatctcagttccggcttgattaaagggatagggccg
aagaaggcaagcctgattgttgagcattttggcgagcagacacttgccattattgagcag
cagcctgagcgtctgcgcgaagtgaaggggataggagctaaggattgtaaccagattatc
aaggcctgggccgagcagagcgaaataaaagaattgcatctcttcttgcagtcacatgat
gtctcgatcaatgtggcgacgcgcatctataagcagtatggtaaggaatcgataaaagtc
attcgcgcaaatccctatcaactagcgcaggaagtgcatggtattggctttcgcactgcc
gatgagatcgctgtgaaactggggttaccgcctgatagtttgcctcgccttgccagcggc
ttgaagtatgtgctcacgcaggctgctaatgaagagggacactgttttttgcgcgaagcc
gatcttatgcaacgggcttcagaggccttgaaagcttcgccggaaatcctgccacatgca
cttgatatcttacggagcgagcaagatatctttgttgagccaccagaagcagcagccacg
gccactcttgatgacgaatgggctgcggaggaagatagtgcggagccaaccaatctacag
gcaagaatttattatgggccgttctggtacgcggagagtggttcggcgcgccttttacga
agtctcctaaattctcctagctcgctgccacctgcgccgcaaaaattgtgggatacagtc
ttcgttctgcttaaacagaaacggaatatgcatttaacagagaagcagcgagctgctgtg
caaatggcttataataataaggtatgtatcctgacaggtggaccaggaacaggaaaatcg
acttccattcgggccctgctcatgttgttgcgcaatcgcaaagttgatgttgctctggct
gcgcctaccgggcgggcggcaaagcggcttgctgaggccaccggagtgcaggctcagacc
cttcaccgtttgctggaatatgcgccgcatgacaatagttatcagcgtaatgaggatagg
ccgctctcacatcaattcgttattgttgatgagttctcaatggttgatattttgcttttt
tatcatcttttgaaagctcttccgcgcgaagcccatttattattggttggagatgctgat
caactaccttcagtcggcccgggaaatgtgctccatgatttattggctggcgaagcaata
cctacggtacggcttaccgagctttttcggcaggcccagcagagtaaaatcattgtgaat
gcgcaccgtatcaatgcaggtgctatgccctcaacgaaaattgaggccaacagcgatttc
ttttttatggccgaggaagaccctatgcgggctcagcaactcattctagatctggtccag
cgccgtttgccggcgcgctatcactttaatccattgaccgacattcaagtattggccccg
atgtataaagggccgataggggttactatgctgaatgagtgcctgcaggagcgcttgaat
cctcgcgcttttgcccaggtggaactaggggatcatatactacgtgttggggataaggtg
atgcaaacgcgcaacaattatgataagggcgtgtttaatggcgatataggttggatacgc
agtattagccgtgagaacgcgacggccaaagtagagtttgtggaagagactggatcaaca
ttcgtgagttatgattttaacgaattagatgagttaacgttagcttatgcggtgacggtg
cataagagccaggggagtgaatatcccgctatcgttcttccccttgtgcttcagcatcgc
atgctcttacagcgcaatctgctctatacagctattacacgggccaagcgtttttgtgtg
cttgttggccagccccaggccctagaaatcgctgtgagaaatgcgcgcatcgcgcagcgc
aatactgctctggcagagcgtctcctggcctggagcaaaggaagcgcccaaacccttgtt
taa

DBGET integrated database retrieval system