KEGG   Ktedonobacterales bacterium SCAWS-G2: EPA93_30575Help
Entry
EPA93_30575       CDS       T05969                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
kbs  Ktedonobacterales bacterium SCAWS-G2
Pathway
kbs03010  Ribosome
Brite
KEGG Orthology (KO) [BR:kbs00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EPA93_30575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:kbs03011]
    EPA93_30575
Ribosome [BR:kbs03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EPA93_30575
  Bacteria
    EPA93_30575
  Archaea
    EPA93_30575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: QBD80093
UniProt: A0A4P6JXF4
Position
7050135..7050485
Genome map
AA seq 116 aa AA seqDB search
MQVRAIAKNIGVSPRKMRLVTNAVKGLRVNEALAVLQFLPQAGATPVRKVVASASANAEN
NYNLNPDDLYILNIVADDSFRIKRVKPRSHGRAARILRRFCHVTVVVSDDPADAGR
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcagggctattgcaaaaaatatcggcgtttcgccgcgtaagatgcgccttgtc
accaacgcggtaaagggacttcgggtaaatgaggctctggctgttcttcagttcttgcct
caggccggcgctactcctgttcgcaaggtggtggcctcagcttcagcaaacgcggagaat
aactataatctcaatccggatgacctgtatattctcaatattgtggcggatgactcgttt
cggattaagcgtgtaaagccgcgctcccatggccgtgcagctcgtattttgcgccgcttc
tgccatgtgacagtggttgtttcagatgatccggctgacgcgggccgctaa

DBGET integrated database retrieval system