KEGG   Candidatus Kinetoplastibacterium blastocrithidii TCC012E: BCUE_0034Help
Entry
BCUE_0034         CDS       T02463                                 

Definition
(GenBank) glutamyl-tRNA synthetase gltX
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
kbt  Candidatus Kinetoplastibacterium blastocrithidii TCC012E
Pathway
kbt00860  Porphyrin and chlorophyll metabolism
kbt00970  Aminoacyl-tRNA biosynthesis
kbt01100  Metabolic pathways
kbt01110  Biosynthesis of secondary metabolites
kbt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kbt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCUE_0034
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCUE_0034
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kbt01007]
    BCUE_0034
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kbt03016]
    BCUE_0034
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:kbt02048]
    BCUE_0034
Enzymes [BR:kbt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     BCUE_0034
Amino acid related enzymes [BR:kbt01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BCUE_0034
Transfer RNA biogenesis [BR:kbt03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BCUE_0034
 Prokaryotic Type
   Other AARSs
    BCUE_0034
Prokaryotic defense system [BR:kbt02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BCUE_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AGF50033
UniProt: M1LC58
Position
680054..681481
Genome map
AA seq 475 aa AA seqDB search
MNSYTNNNVRVRFAPSPTGFLHLGGARTALFSWAFAKHNNGIFLLRIEDTDIKRSTKEAI
KSIMDGMTWLGIISDEEIVYQTQRMERYRELLKKMLNEGNAYYCYSSAEEIDKMREEARK
NETKPKYDGTWRPELNKIMPNIPKDRNPTIRFKNPSTGIVTWNDMVKGRISFKNEELDDL
VIARSDGTPTYNFCVAIDDLDMGISHVLRGDDHVNNTPRQINILKSLNAKIPEYGHLPMI
LGTDGEKLSKRHGAMNIMEYKSKGYLPEAMVNYLARLGWSHNNDEIFNTRQLIDWFDIKH
LSKSPSQWDPKKLDWINSYYIKHTDTHNLVNMVMPMITARNYEPNENDLGSIIDLFKERS
TTLNQLAENAIIFYKETINIADDIKNKCTDDQTIQLIRKFISIANNVDWKIEEIDRVIKT
IITENNITMKQIALPLRIYLTGEANTPSINKVLLLLGKEKVLSRLRKTLDNYKQL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaactcctacactaataataacgtgcgtgttcgtttcgctccatccccaacaggtttc
cttcatctgggaggtgctcgtacagcattgttttcatgggcttttgccaaacacaataac
ggtatatttttattgcgcatagaagatactgacataaagagatcaactaaagaagctata
aaatccatcatggatggcatgacatggttaggaataatatcagatgaagagatagtatat
caaactcaaagaatggagcgctaccgagaattactaaaaaaaatgcttaacgaaggtaat
gcttattactgttatagttcagctgaagaaattgacaaaatgagagaagaagctaggaaa
aatgaaacaaaaccaaaatatgatggcacatggagacctgagcttaataaaataatgcca
aatataccaaaagatcgcaatccaacaataagatttaaaaacccatcaacagggatagta
acatggaatgacatggtaaaaggaaggattagttttaaaaatgaggaacttgatgattta
gtaatagctcgttctgatggcactcctacatataatttttgtgtagccatagatgacctg
gatatgggcatatctcatgtgttacgaggagatgatcatgtcaataatacacctaggcag
attaatatactaaaatcactgaatgcaaaaattcccgaatacggacatctgcctatgata
ttaggaacagatggcgagaagttgtcaaagagacacggggccatgaatattatggaatat
aaatctaaaggctaccttcctgaagcaatggtaaactatttggctcgccttggatggagc
cataataatgatgagatatttaatactaggcagctaatagactggtttgacattaaacat
ctatccaagtctccgtcacaatgggatcctaaaaaacttgactggattaattcatactat
ataaaacatacagatactcataatttagtgaatatggtaatgccgatgataacagctcgc
aattatgagcctaacgaaaatgatctaggatctataatagacctttttaaagaaaggtct
acaactctaaatcaacttgctgaaaatgcaataattttctataaagagactatcaatata
gcagatgatataaaaaataagtgtactgatgatcaaacaattcaacttatacgcaaattc
atttctattgcaaataacgtagactggaaaatagaagaaatagatagagttattaaaact
ataattacagaaaacaatataacaatgaaacaaattgcattgccactaagaatatattta
acaggagaagcaaatactccatctatcaataaagtcttattactattaggtaaggaaaag
gtacttagccgtctaagaaagactcttgataattacaaacagctctaa

DBGET integrated database retrieval system