KEGG   Candidatus Kinetoplastibacterium blastocrithidii TCC012E: BCUE_0099Help
Entry
BCUE_0099         CDS       T02463                                 

Definition
(GenBank) aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
kbt  Candidatus Kinetoplastibacterium blastocrithidii TCC012E
Pathway
kbt00970  Aminoacyl-tRNA biosynthesis
kbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kbt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCUE_0099
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:kbt03029]
    BCUE_0099
Enzymes [BR:kbt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BCUE_0099
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BCUE_0099
Mitochondrial biogenesis [BR:kbt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BCUE_0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln EB1
Motif
Other DBs
NCBI-ProteinID: AGF50089
UniProt: M1M4T0
Position
737127..737435
Genome map
AA seq 102 aa AA seqDB search
MTLDKNDVANIAKLAKIELSTKQCVDTTNELNEILSIIDRIQKINNEDNELITHPISLHE
KISMFLRDDRVIDECSDTLIEKVAKNAPQFEDNMFLVPKVVE
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgataaaaatgatgtagctaatattgccaaattagcaaaaatagaacttagc
acaaaacaatgtgttgataccactaatgaattaaatgaaattctaagtattattgaccgc
atacaaaaaataaacaatgaagataatgaacttattacgcatcccatctcattgcatgaa
aaaatttccatgtttctaagagatgatagagttatagacgaatgctcagatactcttata
gaaaaagttgctaaaaatgctcctcaattcgaagataacatgtttttagttcctaaagta
gttgaatag

DBGET integrated database retrieval system