KEGG   Candidatus Kinetoplastibacterium blastocrithidii TCC012E: BCUE_0177Help
Entry
BCUE_0177         CDS       T02463                                 

Definition
(GenBank) large subunit ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
kbt  Candidatus Kinetoplastibacterium blastocrithidii TCC012E
Pathway
kbt03010  Ribosome
Brite
KEGG Orthology (KO) [BR:kbt00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BCUE_0177
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:kbt03011]
    BCUE_0177
Ribosome [BR:kbt03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BCUE_0177
  Bacteria
    BCUE_0177
  Archaea
    BCUE_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGF50151
UniProt: M1M1K9
Position
complement(791252..791581)
Genome map
AA seq 109 aa AA seqDB search
MVTTAVIRGIHMSAQKVRLVADLIRNKSVAQAVNILAFSPKKAACVIKKAVESAIANAEH
NNGADIDELYVKEIFIDKAQSMKRFSARAKGRGNRIEKQTCHITVKVES
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggtaactactgctgttatccgtggaattcatatgtcagctcaaaaagttcgattggtt
gctgatttaataagaaataagtctgttgcgcaggcggttaatatactagcattttcgcct
aaaaaagctgcttgtgttattaaaaaggctgttgagtctgcgattgctaatgctgagcac
aataatggtgctgatatagatgagttgtatgttaaagagatttttattgacaaggctcag
tctatgaaacgtttttctgctcgcgctaaaggtcgtggtaatagaatcgaaaaacaaact
tgtcatattaccgttaaggtagaatcctag

DBGET integrated database retrieval system