KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0647Help
Entry
CKCE_0647         CDS       T02413                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
kci00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kci01100  Metabolic pathways
kci01110  Biosynthesis of secondary metabolites
kci01130  Biosynthesis of antibiotics
kci01230  Biosynthesis of amino acids
Module
kci_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kci00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKCE_0647 (trpC)
Enzymes [BR:kci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CKCE_0647 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C ATP-synt_ab_C
Motif
Other DBs
NCBI-ProteinID: AFZ83064
Position
complement(673895..674707)
Genome map
AA seq 270 aa AA seqDB search
MNDLLKKIIDVKKDEILASKKNCNEQELLLKINNNDIRSFEKAIHKKIQNGYPAIIAEIK
KASPSKGILSKNFNPSLFATSYEENGAACISVLTDQQFFQGSSEYLKQVKSACSLPILRK
DFIIDDYQILESRAMGADCILLIVSALEKNKLYELENIALELGMDVLVETHNLKEVEIAL
NLKTPLIGINNRNLRNFKTDIKITIDLINFIPEDKIIITESGINSPEDLKFMRENKVNAF
LIGEYFMKSDNPGEQLKTLLSNNIAKTNYI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcttcttaaaaagataatagatgtaaaaaaagatgaaatattggcatctaaa
aaaaattgcaatgaacaagaactattattaaaaattaataataacgatatacgctctttt
gaaaaagcaattcataaaaaaatccaaaatgggtatcctgctattatagcagaaataaaa
aaagcttctccttctaaaggtattttaagtaaaaattttaacccctcattatttgcaacc
agttatgaggaaaacggtgctgcctgtatatctgtattaacagaccaacaatttttccaa
ggttcttcagaatatttaaaacaggtcaaatcagcttgttcattaccaatacttaggaaa
gactttataattgatgactatcaaatattagaatcaagagcaatgggagcagattgcata
ttacttatagtctcagcactagaaaaaaataaactttatgaattagaaaatatagcacta
gaactaggaatggatgttctagtcgaaacacataatttaaaagaagttgaaatagcctta
aatctaaaaactcctttgattggaattaataatagaaatttaagaaattttaaaactgat
ataaaaattacgatagacctcattaactttataccagaagacaaaattataatcacagaa
agtggcataaattcaccagaagatttgaaatttatgagagaaaataaagttaacgcattt
ttaataggagaatatttcatgaaatcagataacccaggagaacagctgaaaacactatta
tcaaataacattgcaaaaacaaattacatttaa

DBGET integrated database retrieval system