KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0695Help
Entry
CKCE_0695         CDS       T02413                                 

Definition
(GenBank) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
kci00450  Selenocompound metabolism
kci00970  Aminoacyl-tRNA biosynthesis
kci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CKCE_0695
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CKCE_0695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kci01007]
    CKCE_0695
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kci03016]
    CKCE_0695
Enzymes [BR:kci01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CKCE_0695
Amino acid related enzymes [BR:kci01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CKCE_0695
Transfer RNA biogenesis [BR:kci03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CKCE_0695
 Prokaryotic type
   Other AARSs
    CKCE_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AFZ83109
Position
complement(722154..722561)
Genome map
AA seq 135 aa AA seqDB search
MQRTLFVTTALPYANGSLHLGHIMEYIQADIWVRSMRMSGHKVYFIGADDAHGAPIMLKA
EAEGISPRELTTRYSLERPLYLNGFYVDFDYWHSTDSEENKELAIEIYKHLKENNLIELR
SINQFYDPVKKNVPC
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcactctctttgttaccactgctttaccttatgccaacggctctttgcatctt
ggacatatcatggaatatatacaagctgacatatgggtaagatctatgagaatgtctggc
cacaaggtatattttatcggagcagatgatgctcatggcgcacctattatgttgaaagcg
gaagcagaaggaatatctccaagagaactaacaactcgttattcattggaaagaccatta
tatttgaatggattttatgtagattttgattattggcactcaacagattcagaagaaaat
aaagaactagccatagaaatatataaacatcttaaagaaaataatttgattgaactacga
agtataaatcaattctatgatccagtaaaaaaaaatgttccttgctga

DBGET integrated database retrieval system