KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0775Help
Entry
CKCE_0775         CDS       T02413                                 

Gene name
bacA
Definition
(GenBank) undecaprenyl pyrophosphate phosphatase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
kci00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:kci00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CKCE_0775 (bacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kci01011]
    CKCE_0775 (bacA)
Enzymes [BR:kci01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     CKCE_0775 (bacA)
Peptidoglycan biosynthesis and degradation proteins [BR:kci01011]
 Precursor biosynthesis
  Diphosphatase
   CKCE_0775 (bacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BacA
Motif
Other DBs
NCBI-ProteinID: AFZ83179
Position
810922..811737
Genome map
AA seq 271 aa AA seqDB search
MFSNFYYFVQTCFLGIIEGITEFIPVSSTAHLIFLGKIIGFDSEESRVFEVFIQAGAMFS
LLVFFREKIKDLVLGLIRLDSKQLLFFRNLLVSIIPTVLIGFCFISRIKDIFNYEIIISI
SLIIGGFIILIVENNYYSNNHRESSIYKISLKQALFIGLLQCLAMIPGVSRSGATIVAGI
VIGLDRRNATEFSFMMAIPTIIGAAMYDIYSNMGLLSSKLCIGMSIGFIASFISAMCVVH
IVIEFVANHSYKIFGWYRIIIGLLMLLMIMQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgtttagtaatttttattattttgttcaaacatgttttttaggcataatagaaggaatc
acagaatttattccagtatctagtaccgctcatttaatatttctaggtaaaatcataggt
tttgattctgaagaaagtagagtatttgaagtttttattcaggctggtgctatgttttct
cttttggtattttttagagagaaaataaaagatttagttttgggtctaatacgtctagat
tctaagcaactattgtttttccgtaatttgttggtgtctattattccaactgtgttgata
ggtttttgttttattagcaggataaaagatatttttaattatgagattattatttccata
tctttaataataggtgggtttattatattaattgtggaaaataattattattctaataat
catagagaaagctcaatatataaaatatcactaaaacaagctttatttataggtttatta
cagtgtttagcgatgattccaggtgtttctcgttcaggagcaacaatagtagctggtatt
gttattgggttagatcgtaggaatgctactgaattttcttttatgatggccatacctaca
attattggtgcagctatgtatgatatatatagcaatatgggtttgttgtcatctaaactt
tgtataggaatgtcaataggttttatagcgtcatttattagcgccatgtgtgtagtacat
attgttattgaatttgtagcaaatcattcgtacaagatatttgggtggtataggataatc
attgggttattgatgctattgatgattatgcaataa

DBGET integrated database retrieval system