KEGG   Kosakonia cowanii: BWI95_04940Help
Entry
BWI95_04940       CDS       T04691                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kco  Kosakonia cowanii
Pathway
kco00052  Galactose metabolism
kco00500  Starch and sucrose metabolism
kco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BWI95_04940
   00500 Starch and sucrose metabolism
    BWI95_04940
Enzymes [BR:kco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     BWI95_04940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: APZ04449
UniProt: A0A1U7DZ61
Position
1060288..1061697
Genome map
AA seq 469 aa AA seqDB search
MASDSLLPAILQAVMKGQPKALSDPFYPNWHLAPVTGLLNDPNGFIQMGGRYHLFYQWNA
LGCQHNHKCWGHWSSADLLHWQHEPIALMPDEEYDRSGCYSGSAVDNDGVLTLCYTGNVK
FDDGTRTAWQCLAVQNRDGGFDKLGPAIPLPNGYTGHVRDPKVWRHGDFWYMVLGAQDLT
LQGKVLLLRSENLWNWQNLGEIAGSGLNGLGDAGYMWECPDLFALGDSTYLICCPQGITR
DEKRWLNTHPSAYLSGELDYDNAQFRHGEFHELDAGFEFYAPQTTQSEDGRRLLVGWMGV
PDGEEMRQPTVANGWIHQMTCLRHLTSRNGKLYQQPVVELQALRGEQQTFNGQADALPAL
DATSLELIVESAGDLTLNFADTLILEWSQSELRLARRSLESGEWHYRYWQGAAHKLQILC
DRSSVEIFINDGEGVMSSRYFPQQPARLTFAGDAEVRARYWSLRACMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgactctctgctgcccgccattttacaggcggtgatgaaaggccagccgaaa
gcgctgagcgaccccttctacccgaactggcacctggcgccggtcaccgggctgctcaac
gatcccaatggatttatccagatgggcgggcgttaccacctgttttatcaatggaacgcg
ctgggctgccagcacaaccacaaatgctgggggcactggagctcagcggatttactccac
tggcagcatgagccgattgcgctgatgccggacgaagagtatgaccgcagcggctgctac
tccggtagcgccgtggataacgacggcgtgctgacgctctgctacaccggtaacgtcaag
tttgacgacggcacgcgcaccgcctggcagtgtctggcggtgcagaaccgtgacggcggc
ttcgataagctcggcccggcgatcccgctgccaaacggctacaccggacacgtgcgcgac
ccgaaagtgtggcgacacggcgacttctggtacatggtgctcggcgcgcaggatctcacc
ttgcagggcaaagtgctgctgctgcgctcggagaacctgtggaactggcagaacctcggt
gagatcgccggcagcggcctcaacggcctgggtgatgcgggctatatgtgggagtgcccg
gatctcttcgcgctcggcgatagtacctatcttatctgctgcccgcaggggatcacgcgt
gatgagaaacgctggctcaacacccacccgagcgcttatctcagcggcgagctggattac
gacaacgcgcagttccgccacggcgagtttcacgagctggacgccgggtttgagttctac
gcaccgcaaaccacgcagagcgaagatggccgccgtttactggtcggctggatgggcgtg
ccggacggggaagagatgcgccagcccaccgtcgccaacggctggatccaccagatgacc
tgcctgcgccacttaacctcgcgcaacggcaagctttatcaacagccggtcgttgagctt
caggcgctgcgcggcgagcagcagaccttcaacggccaggccgacgcgctaccggcgctg
gatgccacgtcgctggaactgatcgtagagagtgcaggcgatctcacgctgaactttgct
gacacgctgatccttgagtggagtcagagtgaactgcgcctcgcgcgcagaagcctcgag
agcggcgagtggcactaccgctactggcaaggcgcggcgcacaagttgcagatcctctgc
gaccgctcaagcgtcgagatctttattaatgatggcgaaggggtgatgagtagccgctac
ttcccgcagcagcctgcgcgcttaacgtttgcgggtgatgcagaagtgcgggcgcgctac
tggtcgttacgagcttgcatggtagaataa

DBGET integrated database retrieval system