KEGG   Kosakonia cowanii: BWI95_05475Help
Entry
BWI95_05475       CDS       T04691                                 

Definition
(GenBank) amidohydrolase
  KO
K22213  6-methylsalicylate decarboxylase [EC:4.1.1.52]
Organism
kco  Kosakonia cowanii
Brite
KEGG Orthology (KO) [BR:kco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BWI95_05475
Enzymes [BR:kco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.52  6-methylsalicylate decarboxylase
     BWI95_05475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_2 Fe_hyd_lg_C
Motif
Other DBs
NCBI-ProteinID: APZ04543
Position
1167087..1168028
Genome map
AA seq 313 aa AA seqDB search
MTCSNRIDVHQHVVPPFWAGELTKHGGDPSGWKSPAWSPDDAINFMDDNQIATGILSLTA
PSITGWHGKGMIDMARKVNEYTAALVQKMPGRFGNFITLPLPDIDASLSEINYAYEHLDA
DGVVLMTNYQGIYLGDERFSSVWDELNRRSAVVFIHPAKPPMASIPGIPGPVIDYPMDTT
RTAIHMVVKGVMKRCQNINVILSHAGGFLPYASYRFAELLPGLHPTLSKDEMLGEMKKFY
FDTALSSSHVALKSLLAFAEPGHILYGSDFPYAPASVSTSFAHQLDNYESYTGNQLREIN
YLNGLKLFPRLMK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacctgttcaaatcgtattgatgttcatcagcatgtggtccctcctttctgggccggt
gaactgaccaaacatggcggagatccatccggatggaaaagtccagcctggtcaccagac
gatgctattaactttatggacgataatcagatcgccacgggaattctctcgcttacggcc
ccaagtattactggatggcatggtaagggcatgattgatatggccagaaaggttaatgaa
tatactgcagctctggtgcagaaaatgcctgggcgttttggtaattttataaccttacca
ttgcctgatattgatgcctcgctgtctgaaattaattatgcctatgagcatttggatgct
gatggtgtggtgctgatgactaactatcagggaatatatttaggagacgagcgtttcagc
tctgtatgggatgaattaaatcgtcgttctgctgttgtgtttatccacccggccaaacca
ccgatggcatcaatacctggtattcccggcccggtaattgattatccgatggacaccacc
cgcactgcgatacatatggttgtaaaaggtgtaatgaagcgttgtcaaaacatcaacgtg
atcctttctcatgcgggaggatttttgccttacgcttcatatcgatttgctgagttgtta
cccggcctgcacccgacgctcagcaaagatgagatgctcggggagatgaaaaaattttac
ttcgacactgcgttgtccagtagtcacgtcgctttgaaaagtctgctggcttttgcagag
ccgggacatatcctttacggtagcgattttccttatgcgcctgcgtccgtcagtacttca
ttcgcccatcagctggataattatgaaagctatacggggaatcagttaagggaaattaat
tatctcaacgggctaaaactcttcccccgtttaatgaaataa

DBGET integrated database retrieval system